PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00107743001
Common NameGSBRNA2T00107743001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 309aa    MW: 33993.5 Da    PI: 10.1539
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00107743001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8221601.5e-49280179
               DUF822  1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleea 79
                         ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR +Gn+klpk++DnneVlkALc+eAGw+ve+DGttyrk +++   +
  GSBRNA2T00107743001  2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKRKRKILMM 80
                         5899******************************************************************998877444 PP

2DUF82226.62e-0810516772146
               DUF822  72 gskpleeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                          g+kp+++ e ++ s+sasp+ss+q        +sp+ sy++sp+sssfpsp+++      +a+sl+p+l++ls+ 
  GSBRNA2T00107743001 105 GCKPMDRVELMNGSTSASPCSSYQ--------PSPRGSYNPSPSSSSFPSPTNI----FGDANSLIPWLKNLSSN 167
                          89**********************........*******************994....34567899999999763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056877.3E-563164IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRIHGNF KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKRKRKILMM QIGRLRFSFY RFSGHGKRQI ETVLGCKPMD RVELMNGSTS  120
ASPCSSYQPS PRGSYNPSPS SSSFPSPTNI FGDANSLIPW LKNLSSNSPS KLPFFHGNSI  180
SAPVTPPLAR SPTRDQVIIP ESGWLSGMQT PQSGPSSPTF SLVSRNPFFD KAAFKMGDCS  240
SPMWTPGQSG NCSPAIPAGV DQNSDVPMAD GMAAEFAFGM VKPWEGERIH GECVSEDLEL  300
TLGNSRTR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17075RKRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.56320.0leaf| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00107743001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankAL1615490.0AL161549.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 49.
GenBankAL0217110.0AL021711.2 Arabidopsis thaliana DNA chromosome 4, BAC clone F13C5 (ESSA project).
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597106.11e-172PREDICTED: BES1/BZR1 homolog protein 3
RefseqXP_013719440.11e-172PREDICTED: BES1/BZR1 homolog protein 3-like
SwissprotO494041e-163BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLA0A078EF070.0A0A078EF07_BRANA; BnaC01g11380D protein
STRINGBra013359.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-145BES1/BZR1 homolog 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]