PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00106620001
Common NameGSBRNA2T00106620001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 277aa    MW: 30042.5 Da    PI: 8.3684
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00106620001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822209.68.5e-6521351146
               DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasasp 90 
                          ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR +Gn+klpk++DnneVlkALc+eAGw+vedDGttyrkg+kp++++e ++ s+sasp
  GSBRNA2T00106620001   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAGWTVEDDGTTYRKGCKPTDRMELMNGSTSASP 91 
                          5899************************************************************************************** PP

               DUF822  91 esslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                          +ss+q        +sp+ sy++sp+sssfpsp++    +  +a+sl+p+l++ls+ 
  GSBRNA2T00106620001  92 CSSYQ--------PSPRGSYNPSPSSSSFPSPTN----PFGDANSLIPWLKNLSSN 135
                          *****........*******************98....56677899****999763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.0E-603132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRIHGNF KLPKHCDNNE VLKALCNEAG  60
WTVEDDGTTY RKGCKPTDRM ELMNGSTSAS PCSSYQPSPR GSYNPSPSSS SFPSPTNPFG  120
DANSLIPWLK NLSSNSPSKL PFFNGNSISA PVTPPLARSP TYDQVTIPDS GWLSGMQTPQ  180
SGPSSPTFSL VSRNPFFDKE AFKMGDSNSP MWTPGQSGNC SPAIPAGVDQ NSDVPMADGM  240
AAEFAFGMVK PWEGERIHGE CVSDDLELTL GNSRTR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.56320.0leaf| seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00444DAPTransfer from AT4G18890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00106620001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737420.10.0PREDICTED: BES1/BZR1 homolog protein 3
SwissprotO494041e-171BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLA0A078EC660.0A0A078EC66_BRANA; BnaA03g43770D protein
STRINGBra012570.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-151BES1/BZR1 homolog 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]