PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00102900001
Common NameGSBRNA2T00102900001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 264aa    MW: 28933.4 Da    PI: 9.0708
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00102900001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.4e-1487131347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+++++ + ++ G+g+Wk I+r + k Rt+ q+ s+ qky
  GSBRNA2T00102900001  87 AWTEEEHKRFLLGLQKVGKGDWKGISRNFVKSRTPTQVASHAQKY 131
                          6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.00680136IPR017930Myb domain
SuperFamilySSF466893.59E-1782136IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-1883134IPR006447Myb domain, plants
SMARTSM007171.2E-884134IPR001005SANT/Myb domain
CDDcd001677.81E-987132No hitNo description
PfamPF002496.6E-1187131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-1087131IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MAAVSSSSET GGGEKGEIML FGVRVVVDPM RKCVSLNNLS DYEKSSPPEE EIPKIGDGDA  60
AGYASANETL QIPSFSGGNR ERKRGIAWTE EEHKRFLLGL QKVGKGDWKG ISRNFVKSRT  120
PTQVASHAQK YFLRRTNLNR RRRRSSLFDI TTETVTGMVH MEQDHHAQDN LLLPETNISS  180
GHQVFPEVAV PTRTEKAPRT VPVTFQASPA FNLNTDAAVP APLSLNLSLS FNLNEQSNSR  240
HSAFTMMPSF SDGDSNSSII RVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.47190.0flower| leaf| microspore-derived embryo| root| seed| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00102900001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530768e-99AK353076.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-16-O16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110306.10.0PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B03e-59MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A078E5Z50.0A0A078E5Z5_BRANA; BnaA08g22290D protein
STRINGBra016530.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24612669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.28e-96MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]