PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00102832001
Common NameGSBRNA2T00102832001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 765aa    MW: 85185 Da    PI: 5.8326
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00102832001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.11.8e-28507557252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           k+i+l++l+++F++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  GSBRNA2T00102832001 507 DKTITLDVLRQHFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 557
                          689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.938491577IPR003035RWP-RK domain
PfamPF020422.5E-25509557IPR003035RWP-RK domain
SuperFamilySSF542774.77E-22663758No hitNo description
PROSITE profilePS5174526.62673756IPR000270PB1 domain
SMARTSM006661.3E-25673756IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2409.9E-20674753No hitNo description
PfamPF005641.4E-18674755IPR000270PB1 domain
CDDcd064072.15E-39674754No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MEDSLVQTEN AIMDTEFMDG LLLDGCWLET TDGSEFLNLT SSDQSSFMWP PTQDTSSICT  60
SEVVSQTYGQ DCASLDEFPW NKRWWIGPGG GGSSITERLL WVPVNRGGKR VLTTREQPYS  120
HDPTCQRLAN YREVSVNYHF SAEKDDSKAL AGLPGRVFLG KLPEWTPDVR FFRSEEYPRV  180
HHAQDCDVRG TLAIPVFEQG SKVCLGVIEV VMTTEMVKLA PELESICRAL QAVDLRSTEV  240
QIPPSLKGCD LSYKAALPEI RNLLRCACET HKLPLAQTWV SCLHQSKSGC RHNDENYIHC  300
VSTIDDACYL GDPTVGEFHE ACSEHHLLKG QGVAGQAFLT NGPCFSPDVS NYKKSDYPLS  360
HHANMFGLHG SVAIRLRCIH TGSVDFVLEF FLPKDCGDVE EQRKMLNALS TIMAHVPRSL  420
RIVTDKELED ESEVIVTPKI EITSEHTKDW LHQSNNPENL GLIFDVGGKA SDEFGLKRGF  480
GYTRDSNINE SSTFSSQMAD TKRTKADKTI TLDVLRQHFA GSLKDAAKNI GVCPTTLKRI  540
CRQHGIQRWP SRKIKKVGHS LQKIQRVIDS VEGVSGLLPI GSFYANFPNL ASSQEPSLQG  600
KTSLPPQPLQ LSKSPVSPYS HSSSSSQCCS SETQLNSDTT TTTDVGGGVL TLSSLENIPQ  660
STNLSLSSLD NDFLRIKVSY GEEKIRFRMG NSRRLSDLLW EIGKRFSIED MSRCDLKYLD  720
EDNEWVLLTC DEDVEECVSV CSTTRSHTIK LLLHVSSHCY NSWQ*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00102832001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893460.0AC189346.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042N05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737919.10.0protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A397YP200.0A0A397YP20_BRACM; Uncharacterized protein
STRINGBra016458.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]