PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00101723001
Common NameGSBRNA2T00101723001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 217aa    MW: 24932.4 Da    PI: 10.0039
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00101723001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.31.1e-103311847
                         HTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding 18 qlGggtWktIartmgkgRtlkqcksrwqky 47
                         ++  g+W++Ia++++ +Rt++qc+ rw ++
  GSBRNA2T00101723001  3 EHEIGNWSKIASHVP-RRTDNQCRRRWMQL 31
                         677789*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.919136IPR017930Myb domain
CDDcd001679.26E-8231No hitNo description
Gene3DG3DSA:1.10.10.601.8E-10230IPR009057Homeodomain-like
PfamPF002494.0E-9331IPR001005SANT/Myb domain
SuperFamilySSF466895.83E-9434IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MAEHEIGNWS KIASHVPRRT DNQCRRRWMQ LYPHQVPLLQ EATRLRKEAI VGNFVDRESQ  60
RPALLECKFL ALPEIPLEPE PEIVAVKKKR KARPRKADAE CESEVSSAAK EWRPKRRRKR  120
LERCSGDVCR QENETVCENI ENLDNGGEVR SLEWCKENQD NVKEKKQSRR RKSVAETSNN  180
STVTTDCSQV KVGVKKLTPR RKVSAVVPVE NQDAPN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113120PKRRRKRL
2167172SRRRKS
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00101723001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013685972.11e-149PREDICTED: myb-like protein L
TrEMBLA0A078E1Y21e-156A0A078E1Y2_BRANA; BnaC05g35410D protein
STRINGBra022280.1-P1e-109(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.15e-46myb domain protein 4r1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]