PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00100394001
Common NameGSBRNA2T00100394001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 93aa    MW: 10635.5 Da    PI: 9.9296
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00100394001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26051.52.9e-16177344100
               DUF260  44 kllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                          k+++++++++r++ ++sl++eAear+rdPvyG+vg+i+ lq++l++l+  l+  k+e
  GSBRNA2T00100394001  17 KIINEIDPSQRQACVDSLCFEAEARIRDPVYGCVGIIRGLQRRLQHLQLSLNISKRE 73 
                          7899********************************************999988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.496174IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-151769IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MEPCAICKEK RQKCTKKIIN EIDPSQRQAC VDSLCFEAEA RIRDPVYGCV GIIRGLQRRL  60
QHLQLSLNIS KRELAMIKHG QIHQHLSVRS RL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-1538211119LOB family transfactor Ramosa2.1
5ly0_B1e-1538211119LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00100394001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024634719.13e-20LOB domain-containing protein 11
SwissprotO648366e-17LBD10_ARATH; LOB domain-containing protein 10
TrEMBLA0A3P5YZP84e-57A0A3P5YZP8_BRACM; Uncharacterized protein
STRINGBo5g010610.11e-55(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.22e-15LOB domain-containing protein 10
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  3. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]