PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00100331001
Common NameGSBRNA2T00100331001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 442aa    MW: 49028.3 Da    PI: 6.6861
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00100331001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.15.1e-10293351563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l++++
  GSBRNA2T00100331001 293 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLLQRDMMGLTNQN 351
                          899******************************************99998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.5E-19289353IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76291354IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-9291350No hitNo description
SuperFamilySSF579591.37E-11293349No hitNo description
PfamPF001708.9E-9293350IPR004827Basic-leucine zipper domain
CDDcd147031.32E-23294343No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MGETDTDMMI HRHHSSLGSC SIPKQQQQQQ EVEINPNNLI RSSAAAQFSS ESGNSNSKRV  60
GVPPTSPYSQ IHSRSMSQPS SFFSFDSLPP LSPSPFRDHD HPSSLFTRLV GECLPPRKSH  120
RRSNSDIPTG LSPIPPTPLE RSTNPFVKKE DMDDLFSAYM NLDNIDASDN LSRDDMESSR  180
ASGTKTNSDT EGDSSSVNES GGGDLNNNNL KRRAGGGDIA PTSRHYRSVS VDSCFMDKLS  240
FADDSLKQVS PTNSVDRAPA FSIEFNNGEF TAAEMKKIMA NDKLAEMAIS DPKRVKRILA  300
NRQSAARSKE RKMRYIVELE HKVQTLQTEA TTLSAQLTLL QRDMMGLTNQ NNELKFRLQA  360
MEQQARLRDA LNEALNGEVQ RLKLAIGESS HNNEADRSKM QSLNAEMFQQ LNISQLRQQQ  420
PQSQSQSQQN GTMSTKPESN E*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00100331001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808391e-172AY080839.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
GenBankAY1504351e-172AY150435.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592919.10.0PREDICTED: transcription factor VIP1
RefseqXP_013592920.10.0PREDICTED: transcription factor VIP1
RefseqXP_013592921.10.0PREDICTED: transcription factor VIP1
TrEMBLA0A0D3DIF70.0A0A0D3DIF7_BRAOL; Uncharacterized protein
TrEMBLA0A3P6F6T20.0A0A3P6F6T2_BRAOL; Uncharacterized protein
STRINGBo7g119550.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-159bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]