PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00100214001
Common NameGSBRNA2T00100214001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 255aa    MW: 29574.2 Da    PI: 5.7114
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00100214001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.91.1e-13135193462
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                           k+ +r+++NRe+A+rsR RK+  i +L++ v +L+ eN++Lk++l+  + + +++ ++
  GSBRNA2T00100214001 135 EKKRKRMESNRESAKRSRMRKQSHINNLRNQVNQLDMENRELKNRLQLFTYQLQRVNTD 193
                          6999******************************************9998888777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.4E-13128190No hitNo description
SMARTSM003385.8E-15132196IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.438134197IPR004827Basic-leucine zipper domain
PfamPF001703.8E-11135186IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-11136189No hitNo description
CDDcd147021.34E-17137182No hitNo description
PROSITE patternPS000360139154IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MLSTVPAFSM SDPGLVNQFQ GFQTGFTPWE WDCSDLFSVN QLSLEPAVPS PCFAESDSGL  60
VKINSGFDDI KPGSDEEYTG FIKTKPGFDE AQSSHGVPDE PDSDDPKQWT AIASLHSGEQ  120
NHNRNTLIQP EMTEEKKRKR MESNRESAKR SRMRKQSHIN NLRNQVNQLD MENRELKNRL  180
QLFTYQLQRV NTDNIQLVAE QDILRLRLSE MRRILMIRQL QQQQQQQWEL NNRRMIMIEQ  240
NPSTIMDHMI YISK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148153KRSRMR
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00100214001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596376.10.0PREDICTED: basic leucine zipper 63-like
TrEMBLA0A3N6RPC90.0A0A3N6RPC9_BRACR; Uncharacterized protein
STRINGBo7g118720.11e-180(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78551840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37730.11e-105basic leucine-zipper 7
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]