PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00099749001
Common NameGSBRNA2T00099749001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 734aa    MW: 81338.2 Da    PI: 6.5189
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00099749001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.73.1e-25166222259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ +++vei+ +g H he
  GSBRNA2T00099749001 166 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSDCCAKK-IECSNDSGNMVEIVTKGLHSHE 222
                          6********************************98.*********************8 PP

2WRKY96.42e-30329386259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++  +++ v+itY+geHnh+
  GSBRNA2T00099749001 329 SDGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVGNTRDVVITYKGEHNHD 386
                          7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.9E-20162224IPR003657WRKY domain
SuperFamilySSF1182901.01E-19163224IPR003657WRKY domain
SMARTSM007742.7E-23165223IPR003657WRKY domain
PROSITE profilePS5081116.685167224IPR003657WRKY domain
PfamPF031067.0E-17167221IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-31313388IPR003657WRKY domain
SuperFamilySSF1182902.48E-26322388IPR003657WRKY domain
PROSITE profilePS5081133.602323388IPR003657WRKY domain
SMARTSM007742.2E-34328387IPR003657WRKY domain
PfamPF031065.8E-23330386IPR003657WRKY domain
HamapMF_0136322.085603706IPR001787Ribosomal protein L21
TIGRFAMsTIGR000614.3E-26604705IPR001787Ribosomal protein L21
SuperFamilySSF1410918.37E-31604704IPR028909Ribosomal protein L21-like
PfamPF008291.5E-32604704IPR028909Ribosomal protein L21-like
PROSITE patternPS011690675697IPR018258Ribosomal protein L21, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006412Biological Processtranslation
GO:0005840Cellular Componentribosome
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 734 aa     Download sequence    Send to blast
MEKSTQETVK NEKVKPEKEL RDGLSQLRDE ESLGTIGDDM EDVHDEAIRE VLAKDQVEDV  60
RENSPVEPND QDVIEVKETD CGKENVASEV VPVDEVAVEN REVEPSPTLN ASSDSSMVET  120
SLPSDPSASQ SQGLLLEQKS DSQVKSYDSR VVMNLSVSPA LRTPPRDGYN WRKYGQKQVK  180
SPKGSRSYYR CTYSDCCAKK IECSNDSGNM VEIVTKGLHS HEPPRKSSFS PREIRAASAV  240
TPVLEVDTVV ATVPSVSATP PPTKENICQS PTTVERKRTC ENEAVEEPEP KRRRVLLKND  300
NTQSSDSVSK PGKKHKLVVH AASDVGISSD GYRWRKYGQK MVKGNPNPRN YYRCTSAGCP  360
VRKHIETAVG NTRDVVITYK GEHNHDTPVP KKRHDTPSSV LLSPTSMRTR LEVQVNIPSS  420
SSQCSVGRES EKQSSEALDV VVKICGSSKL KHMPLAGIEG LHFGCAHIPL TALEGLHELQ  480
LSRRATTALS INQTRLISSL PSLEPRGTSI THATPTPNRS LSRDLPWYTR SQGRHFSSKT  540
NDTDESSDGE DDDNDEDYED SAEMEVEREY SPAEKVEAAA EIGYKVMGPL KPSERLFKPY  600
EPVFAVVQIG SHQFKVSNGD SIFTEKLKFC DINDKLVLTK VLLLGSASQT IIGRPILPEA  660
TVHAVVEEHA LDEKVLIFKK KRRKNYRRTT GHRQELTKLR ITDIQGIEKP EPKIVHKPPK  720
AADTEQPEAE LVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v61_BT2e-25588708115229Ribosomal Protein L21
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275293RKRTCENEAVEEPEPKRRR
2290294KRRRV
3678682KKKRR
4678683KKKRRK
5679683KKRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.215610.0flower| root| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00099749001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931560.0KM593156.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY82) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002867320.10.0hypothetical protein ARALYDRAFT_328625
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A078C5U30.0A0A078C5U3_BRANA; BnaC07g42990D protein
STRINGfgenesh1_pm.C_scaffold_70008520.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]