PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00099379001
Common NameGSBRNA2T00099379001, LOC106346722
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 180aa    MW: 19473.5 Da    PI: 5.617
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00099379001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.7e-133896563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                         ++ +rkq+NRe+ArrsR RK++ ++ L+  v  L +eN   +  +   ++++ ++++e+
  GSBRNA2T00099379001 38 RKRKRKQSNRESARRSRMRKQQHLDDLAAQVTHLRKENGHFIAGIAVTTEHYVTMEAEN 96
                         5789**********************************998888887777777777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.1E-103277No hitNo description
SMARTSM003382.3E-173498IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4043675IPR004827Basic-leucine zipper domain
PfamPF001704.7E-113896IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.55E-113892No hitNo description
CDDcd147024.97E-193989No hitNo description
PROSITE patternPS0003604156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MNKTELGSPT SNSSVSTTGL LNSGSETDLQ QRDLLDERKR KRKQSNRESA RRSRMRKQQH  60
LDDLAAQVTH LRKENGHFIA GIAVTTEHYV TMEAENSILR AQLLELNHRL DSLNEIVDFV  120
ESSSFEMETG QGGGLVDYGG GGGGGGGGFY DGVMNTLNLG FYNQPIMASA STAGDVFNC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13742RKRKRK
25057RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.142355e-63flower| seed
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the micropylar endosperm and radicle tip in early germinating seeds. {ECO:0000269|PubMed:23461773}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00099379001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0237545e-31AC023754.3 Arabidopsis thaliana chromosome I BAC F1B16 genomic sequence, complete sequence.
GenBankAK3188295e-31AK318829.1 Arabidopsis thaliana AT1G75390 mRNA, complete cds, clone: RAFL14-51-H21.
GenBankAK3189915e-31AK318991.1 Arabidopsis thaliana AT1G75390 mRNA, complete cds, clone: RAFL21-81-N15.
GenBankBT0047685e-31BT004768.1 Arabidopsis thaliana At1g75390 gene, complete cds.
GenBankCP0026845e-31CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104708.11e-129PREDICTED: bZIP transcription factor 44-like
RefseqXP_013641596.11e-129bZIP transcription factor 44
SwissprotC0Z2L58e-95BZP44_ARATH; bZIP transcription factor 44
TrEMBLA0A397YNT91e-128A0A397YNT9_BRACM; Uncharacterized protein
TrEMBLM4CHS21e-128M4CHS2_BRARP; Uncharacterized protein
STRINGBra003755.1-P1e-129(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-82basic leucine-zipper 44
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  3. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]