PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00099260001
Common NameGSBRNA2T00099260001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 372aa    MW: 41986.1 Da    PI: 6.5162
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00099260001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.54e-1088131447
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                          +k  rr+++NReAAr+sR+RKka++++Lee   +L++  ++L k
  GSBRNA2T00099260001  88 DKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLSQLEQELEK 131
                          7999**************************98888888776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.5E-980164IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.1E-880132No hitNo description
PROSITE profilePS502179.40487131IPR004827Basic-leucine zipper domain
PfamPF001706.2E-788131IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-789131No hitNo description
PROSITE patternPS00036092107IPR004827Basic-leucine zipper domain
PfamPF141441.0E-28173247IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MMSSTSPTQL ASLRDMGIYE PFQQMVSWGN VFKSDINDHS PNTASSSVIQ VDHNIIKASY  60
PSSSHNQIEA EPSSNDHQEE DDDGRNHDKM KRRLAQNREA ARKSRLRKKA YVQQLEESRL  120
KLSQLEQELE KAKQQGVYSS GSSYVGSSGS INSSIAAFEL EYSHWLEEQS RRVSEIRTAL  180
QAHISDIELK MLVESCLNHY ANLFRMKADA AKADVFYLIS GMWRTSTERF FQWIGGFRPS  240
GLLNVVMPYL QPLTDQQILE VRNLQQSSQQ AEDALSQGID KLQQSLADNI VIDVVMDSND  300
YPSHMGAAVE NLQALEGFVN QADHLRQQTL QQMAKILTTR QAARGLLCLG EYLHRLRALS  360
SLWAARPREH A*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00099260001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533840.0AK353384.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-N08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104597.10.0PREDICTED: transcription factor TGA7-like isoform X2
RefseqXP_013648666.10.0transcription factor TGA7-like isoform X2
SwissprotQ93ZE20.0TGA7_ARATH; Transcription factor TGA7
TrEMBLA0A3N6THZ50.0A0A3N6THZ5_BRACR; Uncharacterized protein
STRINGXP_010416756.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30612766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.10.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]