PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00097340001
Common NameGSBRNA2T00097340001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 644aa    MW: 72185.8 Da    PI: 7.7512
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00097340001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS424.49.2e-1302696371373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                          lv+lL+ c ea+++++ +++++++ar  elasp+g +pm+Rl+ay+teALa r+ar++++++++ pp++ +    +e+++al+++++v+P
  GSBRNA2T00097340001 269 LVNLLTGCLEAIRTRNIAAINHFIARSGELASPRGtTPMTRLIAYYTEALALRVARMWPHIFHITPPRDFE----DESANALRFLNQVTP 354
                          6899*******************************99********************************96....89999********** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                          i+kf h taN+++l+a+eg+ervHiiDfdi+qGlQWp+++q+LasRp++p ++RiTgvg+    sk+el+etg+rL+ fAe+++++f+f+
  GSBRNA2T00097340001 355 IPKFIHYTANSMLLRAFEGKERVHIIDFDIKQGLQWPSFFQSLASRPNPPRHVRITGVGE----SKHELNETGDRLHGFAEAMHLQFQFH 440
                          ************************************************************....9************************* PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + v++rled++l++L+vk+gEa+aVn+v q+h++l + +  +   ++++ lv+s++P  vv++eqea+hns ++ +r++++l+yysa+fd
  GSBRNA2T00097340001 441 P-VVDRLEDVRLWMLHVKEGEAVAVNCVSQMHKTLYDGTGAAV--RDFVGLVRSTNPVAVVIAEQEAEHNSVQLETRVFNSLKYYSAVFD 527
                          *.7*******************************977766666..89******************************************* PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdg..yrve...e 353
                           +++ l+++s  r+k+E++l+grei+n+vaceg++r+erh  +++Wr++le+ GF+++ +se+++ q k+llr+++ +d+  ++ve   e
  GSBRNA2T00097340001 528 VMHKRLGADSLMRVKIEEVLFGREIRNIVACEGSHRQERHVGFGQWRRMLEQLGFRSLGVSEREVLQSKMLLRMYGdGDEefFNVErsdE 617
                          ****************************************************************************6555889**97766 PP

                 GRAS 354 esgslvlgWkdrpLvsvSaW 373
                          + g ++l W d+pL++vSaW
  GSBRNA2T00097340001 618 DGGGVTLRWLDQPLYTVSAW 637
                          678888************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.493243612IPR005202Transcription factor GRAS
PfamPF035143.2E-127269637IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MLAGCSSSSL LSPTRRLRSE AAAATSSAVS VHFPMNTQRL DLPCSSSNFP RKETPSSRPL  60
GRSISLDNIN SNNNNNNKTG GCSLKQSIKL PPLATTRGNA DGFSWNNDNN NNREKKSLKR  120
LAEDKEDESC LSRVKRQRGE TGDEHNMGFW FDHFTPASLP FSLTCSGDND EKLISTQPLR  180
GHPHWVNSVI TELAGLGDKD IESNRPASGS STSASAESHS FRHRVPEPTN GSRHPYTQHG  240
GSAERRTIEN INNNNNNNHR NDTQRDLELV NLLTGCLEAI RTRNIAAINH FIARSGELAS  300
PRGTTPMTRL IAYYTEALAL RVARMWPHIF HITPPRDFED ESANALRFLN QVTPIPKFIH  360
YTANSMLLRA FEGKERVHII DFDIKQGLQW PSFFQSLASR PNPPRHVRIT GVGESKHELN  420
ETGDRLHGFA EAMHLQFQFH PVVDRLEDVR LWMLHVKEGE AVAVNCVSQM HKTLYDGTGA  480
AVRDFVGLVR STNPVAVVIA EQEAEHNSVQ LETRVFNSLK YYSAVFDVMH KRLGADSLMR  540
VKIEEVLFGR EIRNIVACEG SHRQERHVGF GQWRRMLEQL GFRSLGVSER EVLQSKMLLR  600
MYGDGDEEFF NVERSDEDGG GVTLRWLDQP LYTVSAWSVG GSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4529563723374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.225740.0seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894370.0AC189437.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB069A23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613894.10.0PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A078JRL10.0A0A078JRL1_BRANA; BnaCnng67210D protein
STRINGBra026999.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72962743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]