PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00097285001
Common NameGSBRNA2T00097285001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 417aa    MW: 45268.7 Da    PI: 4.6357
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00097285001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS217.37.7e-671773721203
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          lv++L++cAea++++dl+la+al++ + +la++++ +m ++a+yf+++La+r++     l+      ++     s e a +  f+e +P+
  GSBRNA2T00097285001 177 LVHALVACAEAIQQQDLNLADALVKSVGTLAASQAGAMGKVATYFAQGLARRIYA--ADLS----GGSS--VGPSFEEALQMHFYESCPY 258
                          689***************************************************9..2222....2222..222333344445******* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          lkf+h+taNqaIle+v +++rvH+iD++++qG+QWpaL+qaLa Rp+gpps+R+Tgvg+p+++s+++l+++g++La+fA+++gv+fef+ 
  GSBRNA2T00097285001 259 LKFAHFTANQAILESVTTARRVHVIDLGLNQGMQWPALMQALAVRPGGPPSFRLTGVGPPQTESSDSLQQLGWKLAQFAQAIGVEFEFKG 348
                          ****************************************************************************************** PP

                 GRAS 181 lvakrledleleeLrvkp.gEala 203
                          l+a++l+dle+e+++++p  E+l+
  GSBRNA2T00097285001 349 LAAESLSDLEPEMFETRPeSETLV 372
                          ******************777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011293.2E-3842113No hitNo description
PfamPF120415.9E-3342107IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098539.831151416IPR005202Transcription factor GRAS
PfamPF035142.7E-64177372IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MKRGHGETWD PAPQSQQPSG SCEGSSMADN IKGKMADDSN MDELLEVLGY KVRSSEMAEV  60
AQKLEQLEMV LSNDDVGSTV LNDTVHYNPS DLSNWVETML SELNNPESSD LDPTRICEDR  120
SEYGLSAIPG LSAFPKAEEG ADEEASSKRI RLESVGSWGE LTRPVVVVDS QETGVRLVHA  180
LVACAEAIQQ QDLNLADALV KSVGTLAASQ AGAMGKVATY FAQGLARRIY AADLSGGSSV  240
GPSFEEALQM HFYESCPYLK FAHFTANQAI LESVTTARRV HVIDLGLNQG MQWPALMQAL  300
AVRPGGPPSF RLTGVGPPQT ESSDSLQQLG WKLAQFAQAI GVEFEFKGLA AESLSDLEPE  360
MFETRPESET LVKRTTTASF FSIGSTKRFT TTRACSTRWK TVTPYRAKTE SCRRFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-271773494183GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00097285001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013637838.10.0PREDICTED: DELLA protein RGL2
SwissprotQ8GXW10.0RGL2_ARATH; DELLA protein RGL2
TrEMBLA0A078ILA80.0A0A078ILA8_BRANA; BnaC05g47760D protein
STRINGBra031991.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.10.0RGA-like 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]