PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00097213001
Common NameGSBRNA2T00097213001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 340aa    MW: 37085.8 Da    PI: 6.4299
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00097213001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.43.8e-163191257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         r+R+++++eq+ +Le+ F++   +p +ee  ++ k l    ++ +++V++WFqNrR + ++
  GSBRNA2T00097213001 31 RSRWSPKPEQILILESIFNSgMVNPPKEETVRIRKMLekfgKVGDANVFYWFQNRRSRSRR 91
                         89*****************99*************************************997 PP

2Wus_type_Homeobox107.86.5e-353093265
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         +r+RW+P+peQi iLe++++sG+++P+kee+ ri+++Le++Gk++d+NVfyWFQNr++R+r++q
  GSBRNA2T00097213001 30 VRSRWSPKPEQILILESIFNSGMVNPPKEETVRIRKMLEKFGKVGDANVFYWFQNRRSRSRRRQ 93
                         689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.8E-142398IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-92598IPR009057Homeodomain-like
PROSITE profilePS5007111.7262792IPR001356Homeobox domain
SMARTSM003892.4E-62996IPR001356Homeobox domain
PfamPF000466.7E-143191IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MDQEQTPHSA TGHSHSPSSS ASGTTSTEQV RSRWSPKPEQ ILILESIFNS GMVNPPKEET  60
VRIRKMLEKF GKVGDANVFY WFQNRRSRSR RRQRQLQAAA AAATTTTNTC DQTMMVSNNL  120
PQHSGSDLGF GGCSTSNYLF ASSSSYGVGC DNHSNNGMEN LLTMSGEMGY HEANQHHYNY  180
HSSNVESILC PSEQSSNYHY QQGSITVFIN GVPTEVTSGG IDMKATFGED LVLVNSSGVP  240
LPTDQFGFLM LSLQHGEAYF LVISLSLSLP PPSFPSLSLS LSLSLSLSLS LSLSLSLSLS  300
LSLSLSPLTL MLKIENEMEP NWGKVLNCLL QYILIIILK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00097213001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514020.0AY251402.1 Arabidopsis thaliana WOX11 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585030.10.0PREDICTED: WUSCHEL-related homeobox 11-like
SwissprotQ6X7J31e-149WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLA0A078IKW00.0A0A078IKW0_BRANA; BnaC05g48100D protein
STRINGBra031980.1-P1e-154(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28192768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.11e-129WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]