PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00095779001
Common NameGSBRNA2T00095779001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 418aa    MW: 46298.4 Da    PI: 6.6293
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00095779001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS423.12.3e-129404171374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL+++A+++s+++ ++aq++L+ ls ++sp+gd+++Rl++ ft+AL+ r+       ++  ++++++e+ ss++  ++  +++++P+
  GSBRNA2T00095779001  40 LRRLLFTAADFISQSNVSAAQNILSILSSNSSPYGDSTERLVHLFTKALSVRIGL-----SENTATWTANEMASSSTSCYYLWLNQLTPF 124
                          689**************************************************86.....77888899998889999899999******* PP

                 GRAS  91 lkfshltaNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRp......egppslRiTgvgspesgskeeleetgerLakfAee 171
                          ++fshltaNqaIl+a+e++    ++Hi+D+disqGlQWp+L+qaLa+R+       +ppslRiTg+g+    + + l++tg+rL++fA++
  GSBRNA2T00095779001 125 IRFSHLTANQAILDATETNngnGALHILDLDISQGLQWPPLMQALAERSssnpssTPPPSLRITGCGR----DVTVLNRTGDRLTRFANS 210
                          *****************9888799************************97766655699*********....****************** PP

                 GRAS 172 lgvpfefnvlvak..rledl..eleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                          lg++f+f++lv    +l+ l  +++ L+++   gE++aVn+v+ lhr++++++++     ++L+++ksl+P++v+++e+ea+h+++sFl+
  GSBRNA2T00095779001 211 LGLQFQFHTLVIAeeDLAGLllQIRLLALSAvqGESIAVNCVHFLHRFFNDDGDMIG---HFLSAIKSLNPRIVTMAEREANHGDPSFLT 297
                          *********944312443223366666665556**********************99...****************************** PP

                 GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                          rf+eal++++a+fdslea+lp++s+er ++E++++g ei +vva+e aer++rh+++e W+e++++ GF +vp++++a +qaklllr ++
  GSBRNA2T00095779001 298 RFSEALDHFMAIFDSLEATLPPNSRERLTLEQRWFGMEILDVVAAEAAERKQRHRRFEVWEEMMKRHGFANVPIGSFAFSQAKLLLRLHY 387
                          ****************************************************************************************** PP

                 GRAS 346 .sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           s+gy+++  ++sl+lgWk+r L+svS+W+
  GSBRNA2T00095779001 388 pSEGYNLQFLNDSLFLGWKNRLLFSVSSWK 417
                          *****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.61614396IPR005202Transcription factor GRAS
PfamPF035148.0E-12740417IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MLASFKSSSS SSEDATENPP PPPPLCLASS SAATSAAHHL RRLLFTAADF ISQSNVSAAQ  60
NILSILSSNS SPYGDSTERL VHLFTKALSV RIGLSENTAT WTANEMASSS TSCYYLWLNQ  120
LTPFIRFSHL TANQAILDAT ETNNGNGALH ILDLDISQGL QWPPLMQALA ERSSSNPSST  180
PPPSLRITGC GRDVTVLNRT GDRLTRFANS LGLQFQFHTL VIAEEDLAGL LLQIRLLALS  240
AVQGESIAVN CVHFLHRFFN DDGDMIGHFL SAIKSLNPRI VTMAEREANH GDPSFLTRFS  300
EALDHFMAIF DSLEATLPPN SRERLTLEQR WFGMEILDVV AAEAAERKQR HRRFEVWEEM  360
MKRHGFANVP IGSFAFSQAK LLLRLHYPSE GYNLQFLNDS LFLGWKNRLL FSVSSWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-496341726375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00095779001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3242330.0HQ324233.1 Brassica napus cultivar Hua shuang No. 5 transcription factor LAS (LAS) gene, promoter region, 5' UTR and complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590808.10.0PREDICTED: scarecrow-like protein 18
SwissprotQ9ZWC50.0SCL18_ARATH; Scarecrow-like protein 18
TrEMBLA0A078ILY50.0A0A078ILY5_BRANA; BnaA06g00290D protein
STRINGBra038002.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113292733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]