PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00095696001
Common NameGSBRNA2T00095696001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 256aa    MW: 27618.6 Da    PI: 5.569
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00095696001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.21.2e-1095138851
                          HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                          +r   NReA r++R++Kka+ + Le++v+ L+a N++L k+l++
  GSBRNA2T00095696001  95 KRPLGNREAVRKYREKKKAKAASLEDEVARLTAVNHQLVKRLQS 138
                          66677**********************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-984155IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.82E-793138No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-1494156No hitNo description
PfamPF077163.2E-1495145IPR004827Basic-leucine zipper domain
CDDcd146868.44E-1395147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MEDGELEFSN QEVFSTSDMN GLPLTNCSMD TFFDELLMDS NAACTHTHTC NPTGPENAHT  60
HTCFHVHTKI LPEDSDEKVS TDDTAESCGK KGDNKRPLGN REAVRKYREK KKAKAASLED  120
EVARLTAVNH QLVKRLQSQG ALEAEVSRLK CLLVDLRGRI DGEIGSFPYQ KPNVPSFSHM  180
LMNPCNVECG DEVYCLQDGF GGSSQGGVSI NDGCGFDQLQ QCVANQNLVG NGNGSFNSSA  240
NASASNKRKG GHKAA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.122370.0microspore
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00095696001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013717992.10.0basic leucine zipper 19
SwissprotQ8VY761e-141BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A078FYU60.0A0A078FYU6_BRANA; BnaC03g65600D protein
STRINGBo3g167300.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-131bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  3. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  4. Henriques AR,Farias DDR,Costa de Oliveira A
    Identification and characterization of the bZIP transcription factor involved in zinc homeostasis in cereals.
    Genet. Mol. Res., 2017.
    [PMID:28671251]
  5. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  6. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]