PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00095270001
Common NameGSBRNA2T00095270001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 143aa    MW: 16623.3 Da    PI: 7.8579
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00095270001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.71.2e-4152129178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqve+C+ad+s+ak+yhrrhkvCe+h+kapvv +  l+qrfCqqCsrfh+l efDe+krsCrrrLa+hnerrrk+++
  GSBRNA2T00095270001  52 TCQVERCTADMSRAKQYHRRHKVCEFHAKAPVVRIYSLHQRFCQQCSRFHDLGEFDESKRSCRRRLAGHNERRRKSAS 129
                          6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375756.0E-561140IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.109.0E-3246114IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.64150127IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.4E-3752129IPR004333Transcription factor, SBP-box
PfamPF031105.4E-3153126IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MSMKGSKAEA KRSLREMSEE EEEEEEEDTF EEEEALEKKQ KGKATSSSSS STCQVERCTA  60
DMSRAKQYHR RHKVCEFHAK APVVRIYSLH QRFCQQCSRF HDLGEFDESK RSCRRRLAGH  120
NERRRKSASE GERSQNHGSQ DY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3844126284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.135839e-95bud| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00095270001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0054431e-111BT005443.1 Arabidopsis thaliana clone U50647 putative squamosa-promoter binding protein (At2g33810) mRNA, complete cds.
GenBankAK1181791e-111AK118179.1 Arabidopsis thaliana At2g33810 mRNA for putative squamosa-promoter binding protein, complete cds, clone: RAFL19-50-A02.
GenBankY094271e-111Y09427.1 A.thaliana mRNA for squamosa-promoter binding protein like 3.
GenBankAJ2429591e-111AJ242959.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 3 (SPL3 gene).
GenBankAJ0116331e-111AJ011633.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013646802.11e-75PREDICTED: squamosa promoter-binding-like protein 3
SwissprotP930154e-58SPL3_ARATH; Squamosa promoter-binding-like protein 3
TrEMBLA0A078FVP53e-98A0A078FVP5_BRANA; Squamosa promoter-binding-like protein
STRINGBra005470.1-P3e-73(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-50squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]