PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00093807001
Common NameGSBRNA2T00093807001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 372aa    MW: 40601.7 Da    PI: 5.3089
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00093807001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573118.44e-37150241297
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          +fqr+wseeDei++LqGlid++++tg+sp+dd++afy  vkksisf+vsk+q+++Ki  LK K++++  k    +e +fsk+hd+k+f+l
  GSBRNA2T00093807001 150 YFQRVWSEEDEIAVLQGLIDYRNDTGASPYDDTNAFYLSVKKSISFDVSKTQVIKKIWGLKTKYENNLVK----EELTFSKPHDRKAFDL 235
                          79********************************************************************....9*************** PP

               DUF573  92 skkiWg 97 
                          sk +Wg
  GSBRNA2T00093807001 236 SKFVWG 241
                          *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.4E-31151241IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MSGKRFNPLE DPPSASSSDE DDQVKTTSLP GNSSSEDETD DESSKNPSSN KPESAPEKQQ  60
VSNSDSGSDE ETDSDSQTVR VKKNPGSSSD AKSIAGTKDS AVVKNHDSKK VKPLTKKRSL  120
SETDGAAAAA SKEAKKVKSG GSGEEAKKTY FQRVWSEEDE IAVLQGLIDY RNDTGASPYD  180
DTNAFYLSVK KSISFDVSKT QVIKKIWGLK TKYENNLVKE ELTFSKPHDR KAFDLSKFVW  240
GADAAALDSA SKKSSKSSSK KVEPEKQELA SSSSPNGKSC EEEAMTNKGE ASSVVEVDAF  300
DKSVLVKALA RFGVDDLSAQ RGWSRLALED KKRFEEEWKT LQLRELEFYS KKSGFIHEVI  360
TKMAESFPPN P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013693755.10.0PREDICTED: mediator-associated protein 1-like isoform X1
TrEMBLA0A078IIM90.0A0A078IIM9_BRANA; BnaCnng18000D protein
STRINGBra019847.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.11e-60DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]