PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00093777001
Common NameGSBRNA2T00093777001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 133aa    MW: 14641.5 Da    PI: 7.4055
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00093777001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.36.4e-4412110199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC++dCv+apyfp e+p kfanvh++FGasnv+k+l+++ +++red+++sl+yeAear++dPvyG+vg i+ lq+q+ +l
  GSBRNA2T00093777001  12 PCAACKFLRRKCTSDCVFAPYFPPEEPTKFANVHRIFGASNVSKILHEVAPHQREDTVNSLAYEAEARLNDPVYGCVGAISVLQRQVLKL 101
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          + el+++++
  GSBRNA2T00093777001 102 QRELEETNA 110
                          ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.02111112IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MSSSYSSYTN SPCAACKFLR RKCTSDCVFA PYFPPEEPTK FANVHRIFGA SNVSKILHEV  60
APHQREDTVN SLAYEAEARL NDPVYGCVGA ISVLQRQVLK LQRELEETNA DLMRYASSLG  120
GEMTSNYGGH RG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-59101259125LOB family transfactor Ramosa2.1
5ly0_B2e-59101259125LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00093777001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0181141e-117AB018114.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MGF10.
GenBankAB1643041e-117AB164304.1 Arabidopsis thaliana ASL3 mRNA for ASYMMETRIC LEAVES2-like gene 3 protein, partial cds.
GenBankAB4738361e-117AB473836.1 Arabidopsis thaliana ASL3 mRNA for ASYMMETRIC LEAVES2-like 3 protein, complete cds.
GenBankAF4478921e-117AF447892.1 Arabidopsis thaliana LOB DOMAIN 25 (LBD25) mRNA, complete cds.
GenBankCP0026861e-117CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129401.13e-93PREDICTED: LOB domain-containing protein 25-like
RefseqXP_013697798.13e-93LOB domain-containing protein 25-like
RefseqXP_013697803.13e-93LOB domain-containing protein 25-like
SwissprotQ8L8Q31e-85LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A078IL151e-94A0A078IL15_BRANA; BnaA02g28980D protein
STRINGBra033019.1-P1e-92(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-86LOB domain-containing protein 25
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]