PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00091693001
Common NameGSBRNA2T00091693001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 321aa    MW: 35591.2 Da    PI: 7.4996
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00091693001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.9e-1851111257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  GSBRNA2T00091693001  51 KPRWNPKPEQIRILESIFNSgIVNPPREEIQRIRTRLqeygQIGDANVFYWFQNRKSRAKH 111
                          89*****************99*************************************995 PP

2Wus_type_Homeobox111.74e-3650112264
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                          +++RW+P+peQi+iLe++++sG+++P++eeiqri+++L+eyG+i+d+NVfyWFQNrk+R ++k
  GSBRNA2T00091693001  50 PKPRWNPKPEQIRILESIFNSGIVNPPREEIQRIRTRLQEYGQIGDANVFYWFQNRKSRAKHK 112
                          579**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.39847112IPR001356Homeobox domain
SuperFamilySSF466899.84E-1248114IPR009057Homeodomain-like
SMARTSM003891.3E-649116IPR001356Homeobox domain
CDDcd000866.57E-850112No hitNo description
Gene3DG3DSA:1.10.10.602.4E-651110IPR009057Homeodomain-like
PfamPF000461.6E-1551111IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSSSNKNWPS MFKSKPCNKH HHRDMETPSS MPYSNCNTPS PFSSDRVPDP KPRWNPKPEQ  60
IRILESIFNS GIVNPPREEI QRIRTRLQEY GQIGDANVFY WFQNRKSRAK HKLRVLKKNP  120
KMLGCNPSKT RKEKIITPND NPTDPCFGLV NHETGLFPGQ NNELVITEPA SFLYPDDNNP  180
SLTQSAFGFG GFVVPVVAEE RLELAGTSNG VNMNIPEINF GGGENGYFPN SVPVTVPLTI  240
NQSQVSSGGG DIGDYVSPVR LTVFINDMPF DVAAGLFNVK EAFGNNAMLI NSFGQPILTD  300
EFGVTFQPLQ NGAVYYLVSF *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00091693001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128835.10.0PREDICTED: WUSCHEL-related homeobox 8
RefseqXP_013646635.10.0PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ6X7J51e-155WOX8_ARATH; WUSCHEL-related homeobox 8
TrEMBLA0A078ICZ20.0A0A078ICZ2_BRANA; BnaA02g24210D protein
STRINGBra022008.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142621619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.11e-147WUSCHEL related homeobox 8
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]