PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00091530001
Common NameGSBRNA2T00091530001, LOC106348851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 319aa    MW: 34622.4 Da    PI: 8.6404
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00091530001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.12.6e-15158212458
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                          +kr +r+ +NRe+ArrsR+RK+a + eLe+ v +L  eN+ L k l   +++  +
  GSBRNA2T00091530001 158 VKRVKRMLSNRESARRSRRRKQAHLSELETQVSQLRVENSNLMKGLTDVTQTFNE 212
                          79****************************************9998887777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.9E-17155219IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909157220IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.19E-12158209No hitNo description
PfamPF001704.6E-13158207IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-12159208No hitNo description
PROSITE patternPS000360162177IPR004827Basic-leucine zipper domain
PfamPF124984.1E-14226276IPR020983Basic leucine-zipper, C-terminal
PfamPF124988.3E-6284313IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MEKVFSVEET SCNNHLWSEP AKESDGTSGM NRSDSEWAFH RSIQKSSAGE DATAHGASDS  60
GPSSPVDSHE YREILKSKLN LACAAVAMKR GAFIKPQDTS GRSENGGAAY ASSASDQGSL  120
ASSTKATPVM SSTVTSGSEL SCDDEEADGE TNMHPTNVKR VKRMLSNRES ARRSRRRKQA  180
HLSELETQVS QLRVENSNLM KGLTDVTQTF NEASVENRVL KANLETLRAK VKMAEETVKR  240
ITGFNPMFHT MPPVSTVSNP SETSNSLDTS SQVTTPEISS SSNKSKALIG CKMNRTESMR  300
RVASLEHLQK RIRSVGDK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171178RRSRRRKQ
2173178SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.217810.0flower
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Present in silique valves, vasculature and funiculi. {ECO:0000269|PubMed:18841482}.
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, young leaves, pollen, and flowers. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in controlling responses to starvation (PubMed:26263501). BZIP2-BZIP63-KIN10 complex binds to the ETFQO promoter to up-regulate its transcription (PubMed:29348240). {ECO:0000269|PubMed:26263501, ECO:0000269|PubMed:29348240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00091530001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly repressed by glucose. {ECO:0000269|PubMed:18841482}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013644119.10.0basic leucine zipper 63 isoform X1
SwissprotB9DGI81e-158BZP63_ARATH; Basic leucine zipper 63
TrEMBLA0A078ICP70.0A0A078ICP7_BRANA; BnaC07g27440D protein
STRINGBo7g093030.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68462743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-156bZIP family protein
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Brand LH, et al.
    Screening for protein-DNA interactions by automatable DNA-protein interaction ELISA.
    PLoS ONE, 2013. 8(10): p. e75177
    [PMID:24146751]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  5. Mair A, et al.
    SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants.
    Elife, 2016.
    [PMID:26263501]
  6. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]