PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00090973001
Common NameGSBRNA2T00090973001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 151aa    MW: 16538.2 Da    PI: 10.1057
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00090973001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS35.61.3e-1186140155
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55 
                          lv+ L++cAea+++++++ a+al++++  la +++ +m+++a+yf++ L + ++r
  GSBRNA2T00090973001  86 LVHSLMACAEAIKNSKFTIAEALVKQIGFLAVSQAGAMRKVATYFANTLVRWIYR 140
                          689***********************************************99988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011292.8E-6973No hitNo description
PfamPF120412.5E-13953IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS509859.12360150IPR005202Transcription factor GRAS
PfamPF035144.3E-986140IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MMVKKEEDDE HLGVLGYKVR SSRSQEVALK LKQLEAMMGN VQQDGLAHFA MDTQIGGVIR  60
TTITTTTASA SRPVILVDTQ NNGVHLVHSL MACAEAIKNS KFTIAEALVK QIGFLAVSQA  120
GAMRKVATYF ANTLVRWIYR LRVNLANHTH *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00090973001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307228.12e-39hypothetical protein CARUB_v10008833mg
SwissprotQ9LQT88e-38GAI_ARATH; DELLA protein GAI
TrEMBLA0A078FU951e-108A0A078FU95_BRANA; BnaA02g12260D protein
STRINGfgenesh2_kg.1__1634__AT1G14920.15e-37(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.14e-29GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]