PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00090513001
Common NameGSBRNA2T00090513001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 164aa    MW: 19508.9 Da    PI: 8.4443
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00090513001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.3e-1353103555
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                          +++rr+++NRe+ArrsR RK+  ++eL   v  L + N+ L+++l++ ++ 
  GSBRNA2T00090513001  53 RKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLIDKLNNVSES 103
                          79****************************************999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.8E-1449113IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.04851103IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-1153126No hitNo description
PfamPF001709.5E-1253104IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.19E-1253102No hitNo description
CDDcd147021.09E-1554104No hitNo description
PROSITE patternPS0003605671IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MQSEVIIFLS SSITTFFLNE QIFTKKKKKI KYIYIYIYAS DEDHQQSMAI DERKQRRMIS  60
NRESARRSRM RKQRHLDELW SQVIRLRTDN HCLIDKLNNV SESHELALKE NAKLKEETSD  120
LRQLLSEIKS NNEDDNNFLR DLEDSISNTR SGSDQRGRDF ELY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16572RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00090513001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0271341e-142AC027134.4 Arabidopsis thaliana chromosome I BAC F13B4 genomic sequence, complete sequence.
GenBankAF3324301e-142AF332430.1 Arabidopsis thaliana clone C00105 (e) putative bZIP transcription factor (At1g13600) mRNA, complete cds.
GenBankCP0026841e-142CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF21F231e-142AC027656.4 Sequence of BAC F21F23 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009117984.19e-85PREDICTED: basic leucine zipper 43-like
RefseqXP_009117985.19e-85PREDICTED: basic leucine zipper 43-like
RefseqXP_013731084.19e-85basic leucine zipper 43-like
SwissprotQ9FMC25e-30BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A078FT601e-113A0A078FT60_BRANA; BnaC08g40240D protein
STRINGBra026895.1-P3e-84(Brassica rapa)
STRINGBra026896.1-P3e-84(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.18e-77basic leucine-zipper 58
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]