PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00090272001
Common NameGSBRNA2T00090272001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 445aa    MW: 47908.4 Da    PI: 9.4203
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00090272001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.82.1e-12305363563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          kr +r   NR++A rs +RK ++++eLe kv++L++e ++L  +l +l+  +  l++++
  GSBRNA2T00090272001 305 KRVKRILANRVSAARSKERKTQYMAELEHKVQTLQSEATTLSAQLTHLQRDSMGLTNQN 363
                          899*********************************************99887777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.0E-20301365IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.955303366IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.61E-12305361No hitNo description
PfamPF001704.6E-10305362IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-12305361No hitNo description
CDDcd147034.75E-23306355No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0010628Biological Processpositive regulation of gene expression
GO:0010629Biological Processnegative regulation of gene expression
GO:0090567Biological Processreproductive shoot system development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MQRATSSSSS IPKQPLPITP NHHLNPPLLR SPQPFSADGA GNRVGAPPPI PSYSQIPATL  60
QLKHSRSTSQ PSSFFSFDSL PPLNPSPVSV DERNGAGFSP SLPPSPFTMC HSSSRMVGGG  120
GDGENLPPRK SHRRSNSDVT FGFSSVMSPP LIPSRSLERS VSGGGEASSD CEAMDDVFRA  180
YMNLDNIDVL NSFGGNETVD SSGTRKSSSD SEGESSAKVS SGVKRRAGGD IAPTGRHCRS  240
VSMDSGFMGK LDFGGDEKLP VKASPTNSGE GNSSVEFGNS EFTAAEMKKI SADEKLAEIV  300
MADPKRVKRI LANRVSAARS KERKTQYMAE LEHKVQTLQS EATTLSAQLT HLQRDSMGLT  360
NQNNELKFRL QAMEQQAQLR DALSEKLTEE VQRLKMVIGE TSSRSSSSSS RRESNISKTT  420
LSPEMFQQLS ISQQQMQHSK AQIK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1317325ARSKERKTQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.172840.0flower| seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00037PBMTransfer from AT2G21230Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00090272001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4012981e-136AF401298.1 Arabidopsis thaliana transcription factor bZIP30 (BZIP30) mRNA, complete cds.
GenBankAY0544971e-136AY054497.1 Arabidopsis thaliana putative bZIP transcription factor (At2g21230; F7O24.5) mRNA, complete cds.
GenBankAY0932681e-136AY093268.1 Arabidopsis thaliana putative bZIP transcription factor (At2g21230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140260.10.0PREDICTED: transcription factor RF2a-like
RefseqXP_009140261.10.0PREDICTED: transcription factor RF2a-like
RefseqXP_018514129.10.0PREDICTED: transcription factor RF2a-like
TrEMBLA0A078FSL90.0A0A078FSL9_BRANA; BnaA04g12020D protein
STRINGBra030314.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156251417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.11e-156bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]