PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00090271001
Common NameGSBRNA2T00090271001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 426aa    MW: 46715.1 Da    PI: 6.2022
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00090271001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.92.4e-09280325450
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                           kr +r+ +NRe+A rs ++K  +  eLe kv+ Le++ ++L     
  GSBRNA2T00090271001 280 PKRLKRRLSNRESAARSKEKKALQKFELEVKVERLETQIDTLTAV-L 325
                          59************************************9999843.3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.5E-8276324No hitNo description
SMARTSM003382.1E-4277340IPR004827Basic-leucine zipper domain
PfamPF077164.0E-9278322IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.117279321IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.23E-8281326No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MDGHADIPPS HSGLSQYPRA NPFGDESSNR ATMPPPSGSS LPPFPCPQIP PTGQPSQYGS  60
TPSWSTLPQP SSSLLSFPPL SPSSFLDFPS ATVAYPPVPY TGGSGSSLPS SVFSVQPPYR  120
GFPSATVANN DMALPPIAYM MPNSSSAEGK AHKRASSDSI RLNSLMASNR TYPNPIDMPV  180
GVRTQNESVG DKSSSHNEDV NVNVDVPNGN KRRAANEIAP PRRIWRSVSA GSSLNEAPSL  240
PQGVSVDVGN DTAFGGMFTP EQLRKIASSD ELKEMAASDP KRLKRRLSNR ESAARSKEKK  300
ALQKFELEVK VERLETQIDT LTAVLKLEKV ITILLVTRER MAERMAADHE CARLRTSLDG  360
ADEQARVHHD LIEQLNGEVR RLTEEASRLR EEVNEYRRRE SERMNANMLE QLNINQFEET  420
DYNFE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279285PKRLKRR
2279286PKRLKRRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00090271001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013716937.10.0transcription factor RF2a-like
TrEMBLA0A078FU530.0A0A078FU53_BRANA; BnaA04g12030D protein
STRINGBra030312.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1940967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.36e-28bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]