PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00089773001
Common NameGSBRNA2T00089773001, LOC106362221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 322aa    MW: 35447.2 Da    PI: 5.2318
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00089773001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.5e-10133182554
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                          kr++r   NR +A rs +RK  +i+eLe++v++L++e ++L  +l   + 
  GSBRNA2T00089773001 133 KRAKRILANRQSAARSKERKARYIQELERRVQSLQTEATTLSAQLTLFQR 182
                          9****************************************998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-16129193IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909131194IPR004827Basic-leucine zipper domain
PfamPF001702.7E-8133181IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.89E-10133184No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-8133178No hitNo description
CDDcd147033.97E-21134183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MDKPDPPPNP NADPVPSSFH RRTRSDDMSM FMFTDPLSSA AAPPSSDDLP SDDDLFSSFI  60
DVDSLSSNPN PPISFPDPSS AAVPPPNSSS RPRHRHSNSV DAGCAMYAGD EIMDAKKAMP  120
PEKLSELWSI DPKRAKRILA NRQSAARSKE RKARYIQELE RRVQSLQTEA TTLSAQLTLF  180
QRDTNGLANE NTELKMRLQA MEQQAHLRNA LNEALRKEVE RMKMETGEIS GNSDSFDMGM  240
QQVQYSPSTF MAIPPYHHGS INNGQDMQQM RGFNQMSNSQ SVSEFLQNGR LQGLEISSNN  300
SSSLVKSEGP SLSGSESSSA Y*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269|PubMed:27896439}.
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00129DAPTransfer from AT1G06850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00089773001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0110017e-41AC011001.2 Arabidopsis thaliana chromosome I BAC F4H5 genomic sequence, complete sequence.
GenBankAJ4198527e-41AJ419852.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
GenBankAJ4198537e-41AJ419853.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
GenBankAY0624747e-41AY062474.1 Arabidopsis thaliana Similar to bZIP transcription factors (At1g06850; F4H5.7) mRNA, complete cds.
GenBankBT0001027e-41BT000102.1 Arabidopsis thaliana Similar to bZIP transcription factors (At1g06850) mRNA, complete cds.
GenBankCP0026847e-41CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013657521.10.0transcription factor RF2b
SwissprotO228739e-80BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A078FME00.0A0A078FME0_BRANA; BnaA08g28740D protein
STRINGBra030663.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-120basic leucine-zipper 52
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  4. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  6. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]