PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00089749001
Common NameGSBRNA2T00089749001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 197aa    MW: 22361.9 Da    PI: 10.093
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00089749001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.81e-3419110192
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g +++++++l+  
  GSBRNA2T00089749001  19 ACASCKHQRKKCNNECILSPYFPARKNKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSESLTWEALWRQKDPVLGSYGEYRRISEELKVY 108
                          7***********************************************************************************999887 PP

               DUF260  91 ka 92 
                          k+
  GSBRNA2T00089749001 109 KS 110
                          75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.86718118IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-3219109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MQRNSNNNNI SNNPSSHQAC ASCKHQRKKC NNECILSPYF PARKNKEFQA VHKVFGVSNV  60
QKMVRTVREE DRTKLSESLT WEALWRQKDP VLGSYGEYRR ISEELKVYKS LVHNQPLIGW  120
DNNQRVLNNN NKNGLAVNSS GSGGFTVNNN GVGVNRDVIN GGYLSRSGYE NLRQDQRQQC  180
YAVINGFKQH YLPLSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-181196388LOB family transfactor Ramosa2.1
5ly0_B1e-181196388LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.111030.0flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00089749001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013655299.11e-143LOB domain-containing protein 2
RefseqXP_022546537.11e-143LOB domain-containing protein 2
SwissprotQ9LNB91e-111LBD2_ARATH; LOB domain-containing protein 2
TrEMBLA0A078FRW41e-142A0A078FRW4_BRANA; BnaA08g28560D protein
TrEMBLA0A291LQY01e-142A0A291LQY0_BRARR; Transcription factor LBD2
TrEMBLA0A397YKC71e-142A0A397YKC7_BRACM; Uncharacterized protein
STRINGBra030647.1-P1e-123(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.17e-85LOB domain-containing protein 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]