PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00089357001
Common NameGSBRNA2T00089357001, LOC106391896
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 565aa    MW: 61552.4 Da    PI: 4.5279
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00089357001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS280.35.8e-862025633374
                 GRAS   3 elLlecAeavssgdle...laqalLarlselaspdgd....pmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                          e+L+++A  ++  d++   laq +Larl+++ +++      p+qR+a y+te L++ l+        +lpp +t       ++aa+++fs
  GSBRNA2T00089357001 202 EQLFNAAAELTGTDNNnpvLAQGILARLNQNLNNNLHnpkpPFQRAALYVTESLQSLLQP-------SLPPPHT----LLLKIAAYRAFS 280
                          67777777776655444679**********944443224569*****************9.......4555444....7999******** PP

                 GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesg.skeeleetgerLakfAeel 172
                          e+sP+l+f ++taNq+Ile++e+ +r+ i+Dfd++ G+QW +L+q+La+R++++p  sl+iT ++sp+++ ++ el+ t+e+L+ fA e+
  GSBRNA2T00089357001 281 ETSPFLQFVNFTANQTILESLERFDRIRIVDFDVGFGGQWSSLIQELANRSSSAPlsSLKITSFSSPSTVsDEFELRFTEENLRAFAGET 370
                          ***************************************************8888889**********9999****************** PP

                 GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                          gv+fe ++l +++l +  l+ Lr + +Ea+aVnl ++             + + +L+++k++sP+vvv+++      +++F + +++al+
  GSBRNA2T00089357001 371 GVTFEMEMLNMETLLNPPLSLLRSSDKEAIAVNLPISSVIS--------GYLPLILRFLKQISPNVVVCSDT---IPDAPFPNAVVDALH 449
                          *********99************************954443........36677***************986...5778*********** PP

                 GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                          yy++l++sle+  ++ +e+ +++Er++++++i  +++++ ++    + +   W + ++++GF+pv++s++a++qa++ll++ +++g+++e
  GSBRNA2T00089357001 450 YYTSLLESLESPNSSSQEAVASIERFCVQPWIHRLLTNRYRW----MDKSPPWISLFGQCGFTPVAMSQTAETQAEYLLQRNPMRGFHLE 535
                          *********99988999999**********************....999***************************************** PP

                 GRAS 353 ee......sgslvlgWkdrpLvsvSaWr 374
                          ++        slvl+W++++Lv+vSaW+
  GSBRNA2T00089357001 536 KRqsssftTSSLVLCWQKKELVAVSAWK 563
                          88777777899****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098536.706175537IPR005202Transcription factor GRAS
PfamPF035142.0E-83202563IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MPLPFEELQG LGFSYGTRED LCCVVGVNNG SSEPTSVLDS SRSPSPFLSS STTTLSSSHG  60
GPGAAAAGKC NQMAFEDLDG VLSGSPGQEQ SIFRLIMSGD VVDPGSEFMG FDPGSGSDPN  120
PLFGYGFPLD EPPPEEEDLK FQITTDPNPC FFSGGSSPPA KRLNSGQPVS HQWGFPFSDP  180
GHPFLAPPPK LAGTETTAVI TEQLFNAAAE LTGTDNNNPV LAQGILARLN QNLNNNLHNP  240
KPPFQRAALY VTESLQSLLQ PSLPPPHTLL LKIAAYRAFS ETSPFLQFVN FTANQTILES  300
LERFDRIRIV DFDVGFGGQW SSLIQELANR SSSAPLSSLK ITSFSSPSTV SDEFELRFTE  360
ENLRAFAGET GVTFEMEMLN METLLNPPLS LLRSSDKEAI AVNLPISSVI SGYLPLILRF  420
LKQISPNVVV CSDTIPDAPF PNAVVDALHY YTSLLESLES PNSSSQEAVA SIERFCVQPW  480
IHRLLTNRYR WMDKSPPWIS LFGQCGFTPV AMSQTAETQA EYLLQRNPMR GFHLEKRQSS  540
SFTTSSLVLC WQKKELVAVS AWKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2727656380375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00089357001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013688082.10.0PREDICTED: scarecrow-like protein 22
SwissprotQ9M0000.0SCL22_ARATH; Scarecrow-like protein 22
TrEMBLA0A078IEB30.0A0A078IEB3_BRANA; BnaC04g22080D protein
STRINGAT3G60630.10.0(Arabidopsis thaliana)
STRINGfgenesh2_kg.5__2529__AT3G60630.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150661619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60630.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]