PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00088384001
Common NameGSBRNA2T00088384001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 692aa    MW: 78369.5 Da    PI: 6.8548
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00088384001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.23.7e-1113166861371
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL++cA+avss+d ++a+ lL ++++++s++gd ++Rla+y++  L+arla++++++y al++++ts    s+ l+a++++  v+P+
  GSBRNA2T00088384001 316 LRTLLVSCAQAVSSNDRKMAEDLLRQVRQHSSSHGDGTERLAHYLADSLEARLAGTGTQIYTALSSKKTS---ASDMLKAYQTYISVCPF 402
                          6789**************************************************************9999...9**************** PP

                 GRAS  91 lkfshltaNqaIleavege.ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                           k + + aN+ I+  + ++ +++HiiDf+is+G+QWp+L++ La R++g+ +lRiTg++ p+ g   +e ++etgerLa+++++ +vpfe
  GSBRNA2T00088384001 403 KKTAIIFANHSIMHLAPTDaKTIHIIDFGISYGFQWPPLIHRLAWRRGGSCKLRITGIELPQRGfrPAEGVNETGERLARYCQRYNVPFE 492
                          **************99888799****************************************99************************** PP

                 GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          +n  +a+++e+++le+L++++gE +aVn+ ++  +llde+v+++s+rd+vLkl+k+++P+v++ +    ++n++ F++rf e l +ys+l
  GSBRNA2T00088384001 493 YNG-IAQKWETIKLEDLKLREGEFVAVNSLFRFRNLLDETVAVHSPRDAVLKLIKKIKPNVFIPAVLSGSYNAPFFVTRFREVLFHYSSL 581
                          ***.7************************************************************************************* PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesg 356
                          fd+ +++lpr +  r++ E+e+ grei+nvvaceg+er+er e++++W++r ++aGF++++l+++ +++ kl+++  + s+++ v+++ +
  GSBRNA2T00088384001 582 FDMCDTSLPRGDPMRVMFEKEFYGREIMNVVACEGSERVERPESYKQWQARAMRAGFRQLTLEKELVQKLKLMVESGYrSKEFDVDQDGN 671
                          ***************************************************************************99999********** PP

                 GRAS 357 slvlgWkdrpLvsvS 371
                          +l++gWk+r +++ +
  GSBRNA2T00088384001 672 WLLQGWKGRIVYASC 686
                          **********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.433290668IPR005202Transcription factor GRAS
PfamPF035141.3E-108316686IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MGSYSAGFPG SFDNFDFNYD DVFYLDDQAL LEIPSPFPPP PPAPPHPDPY SHAADAESDF  60
SDSVLKYISQ VLMEEDMEEK PCMFHDALSL QAAEKSLYEA LGQKYPDHSE RLAHSPDGSS  120
PGYASSTTSS DWSFDCLENS RRPSWLHSPI PNNFVFKSTR SNPKPSGGSN VALKSSFNND  180
LVSNMFNDSE LAFQFNRGKE EASKFLPKSS QLVIDHHSVL PYRSTGKKKH WREDEHLLSE  240
ERSKKQSAVY VDEAELSEMF DKVLLFGRPK EQPLCILNDN FIKETAKDSS SSYKSDATQQ  300
KHAASGNSYM KETPDLRTLL VSCAQAVSSN DRKMAEDLLR QVRQHSSSHG DGTERLAHYL  360
ADSLEARLAG TGTQIYTALS SKKTSASDML KAYQTYISVC PFKKTAIIFA NHSIMHLAPT  420
DAKTIHIIDF GISYGFQWPP LIHRLAWRRG GSCKLRITGI ELPQRGFRPA EGVNETGERL  480
ARYCQRYNVP FEYNGIAQKW ETIKLEDLKL REGEFVAVNS LFRFRNLLDE TVAVHSPRDA  540
VLKLIKKIKP NVFIPAVLSG SYNAPFFVTR FREVLFHYSS LFDMCDTSLP RGDPMRVMFE  600
KEFYGREIMN VVACEGSERV ERPESYKQWQ ARAMRAGFRQ LTLEKELVQK LKLMVESGYR  660
SKEFDVDQDG NWLLQGWKGR IVYASCTLVP M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-433136432328GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.172311e-88seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00088384001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125052.10.0PREDICTED: scarecrow-like protein 33 isoform X3
SwissprotP0C8830.0SCL33_ARATH; Scarecrow-like protein 33
TrEMBLA0A078IFB40.0A0A078IFB4_BRANA; BnaA07g14230D protein
STRINGBra028390.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]