PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00087217001
Common NameGSBRNA2T00087217001, LOC106407808, LOC106434481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 638aa    MW: 71564.4 Da    PI: 7.2077
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00087217001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS418.84.8e-1282556291373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                          lv+lL+ c ea+++++ +++++l+ar  elasp+g +pm+Rl++y+teALa r++r++++++++ pp+e +++   e   a +++++++P
  GSBRNA2T00087217001 255 LVNLLTGCLEAIRTRNIAAINHLIARTGELASPRGtTPMTRLISYYTEALALRVSRMWPHIFHIAPPREFERT--LEDDDAWRFLNQATP 342
                          6899*******************************99*********************************964..44446999******* PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                          i+kf h taN+++l+a+eg ervHiiDfdi+qGlQWp+++q+LasR+++p ++RiTgvg+    sk el+etg+rL+ fAe++++pfef+
  GSBRNA2T00087217001 343 IPKFIHYTANEMLLRAFEGRERVHIIDFDIKQGLQWPSFFQSLASRSNPPRHVRITGVGE----SKLELNETGDRLHGFAEAMNLPFEFH 428
                          ************************************************************....************************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + v++rled++l++L+vk+gEa+aVn+ +q+h++l ++++   + ++++ lv+s++P  vv++eqea+h+s+++ +r++++l+yysa+fd
  GSBRNA2T00087217001 429 P-VVDRLEDVRLWMLHVKEGEAVAVNCLMQMHKTLYDDGTGGAAFRNFVGLVRSTNPVAVVIAEQEAEHDSAQLETRVCNSLKYYSAVFD 517
                          *.7*************************************************************************************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdg.yrveee.. 354
                           +++ l ++s  r+k+E++l+grei+n+vaceg++r+ rh  +++Wr+++e+ GF+++ +se+++ q k+llr+++  ++g ++ve +  
  GSBRNA2T00087217001 518 VMHTHLRADSLMRVKIEEVLFGREIRNIVACEGSHRQGRHVGFGQWRRMMEQLGFRSLGVSEREVLQSKMLLRMYGdgDEGfFNVERSae 607
                          ***************************************************************************974455999995455 PP

                 GRAS 355 ...sgslvlgWkdrpLvsvSaW 373
                              g ++l W ++pL+++SaW
  GSBRNA2T00087217001 608 dgdGGGVTLRWLEQPLYTISAW 629
                          56466777************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.649229602IPR005202Transcription factor GRAS
PfamPF035141.7E-125255629IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MLAGCSSSSL LSPTRRLRSE AVAATVSVHF PMNTQRLDLP CSSSFSRKEP IERKSGGCSL  60
KQSIKLPPLA TTRGNTEGFS WNNDNNIVKK KKKSLKRFAE ENKEDKSCLS RVKRQRGGDD  120
DHNRGFWFEH LTTQNSSQAL PFSLTCSGDD YEEKVWFAPS EVISQPLQSN NPNWANSVIT  180
TELAGLGDKD IDSSSRPAAV KEASGSSTSA SSDSRHRVPE PTNGSRNQYS HGGGNTEERT  240
INNNHMNDSQ RDFELVNLLT GCLEAIRTRN IAAINHLIAR TGELASPRGT TPMTRLISYY  300
TEALALRVSR MWPHIFHIAP PREFERTLED DDAWRFLNQA TPIPKFIHYT ANEMLLRAFE  360
GRERVHIIDF DIKQGLQWPS FFQSLASRSN PPRHVRITGV GESKLELNET GDRLHGFAEA  420
MNLPFEFHPV VDRLEDVRLW MLHVKEGEAV AVNCLMQMHK TLYDDGTGGA AFRNFVGLVR  480
STNPVAVVIA EQEAEHDSAQ LETRVCNSLK YYSAVFDVMH THLRADSLMR VKIEEVLFGR  540
EIRNIVACEG SHRQGRHVGF GQWRRMMEQL GFRSLGVSER EVLQSKMLLR MYGDGDEGFF  600
NVERSAEDGD GGGVTLRWLE QPLYTISAWG IGGSSSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-4528162923374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.225740.0seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894370.0AC189437.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB069A23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608699.10.0PREDICTED: scarecrow-like protein 28
RefseqXP_013704123.10.0PREDICTED: scarecrow-like protein 28
RefseqXP_013730810.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A078IB140.0A0A078IB14_BRANA; BnaCnng14890D protein
TrEMBLA0A0D3E3T90.0A0A0D3E3T9_BRAOL; Uncharacterized protein
STRINGBra027620.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72962743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]