PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00086315001
Common NameGSBRNA2T00086315001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 335aa    MW: 37386.4 Da    PI: 9.9088
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00086315001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.36.8e-082032401754
                          HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                          A+rsR RK+++i eLe+ v++L+ae ++   el+ l++
  GSBRNA2T00086315001 203 AQRSRVRKLQYISELERNVQTLQAEGSKVSAELDFLNQ 240
                          89**************************9999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0073192251IPR004827Basic-leucine zipper domain
CDDcd147031.34E-14195242No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-7203245No hitNo description
SuperFamilySSF579597.74E-6203245No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAGTKGSESV RSLMNPGKSA LLPPKIPFPS GSMGSRHSHK VSVEKAHQRT SSESHLVEEE  60
LPFWLDDLLN EPESPARKSG HRRSASDSYA YLDVANAATT ISDFSYRNPA ASIQRGIQEL  120
DPSQDASFYA DGSFLKQRNR PSGARPSWTR ESVGGGKHMG ASSYMSQDAT AETKRFSSEE  180
NNSNPQPGAY EADNTKRAKQ QFAQRSRVRK LQYISELERN VQTLQAEGSK VSAELDFLNQ  240
RNLILSLENK ALKHRLESIA QEKLIKQLEQ EVLEREIGRL RALHQQQQHT RQQSASHKRA  300
SSKDLDSQFS TLSLNAKDSN CRRDSLSVMG QFHF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00086315001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0039801e-152BT003980.1 Arabidopsis thaliana clone RAFL15-22-D03 (R20596) putative bZIP family transcription factor (At1g58110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593065.10.0PREDICTED: uncharacterized protein At4g06598 isoform X1
SwissprotQ8W3M76e-44Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLA0A078IBX90.0A0A078IBX9_BRANA; BnaC01g27680D protein
TrEMBLA0A3P6FTC60.0A0A3P6FTC6_BRAOL; Uncharacterized protein
STRINGBo1g087780.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-163bZIP family protein
Publications ? help Back to Top
  1. Kumekawa N,Hosouchi T,Tsuruoka H,Kotani H
    The size and sequence organization of the centromeric region of Arabidopsis thaliana chromosome 4.
    DNA Res., 2001. 8(6): p. 285-90
    [PMID:11853315]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]