PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00084708001
Common NameGSBRNA2T00084708001, LOC106391725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family VOZ
Protein Properties Length: 487aa    MW: 54548.8 Da    PI: 5.2608
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00084708001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ415.11.3e-1272234371215
                  VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                          pppsaflgpkcalwdctrpa+gs+w+ dycs +h +lalne++pg +pvlrp+gi+lkd+ll++al+ak+ gk+vgipecega+++k+pw
  GSBRNA2T00084708001 223 PPPSAFLGPKCALWDCTRPAHGSDWYLDYCSDYHGNLALNEDSPGAAPVLRPGGISLKDNLLIDALRAKTLGKNVGIPECEGAVNTKCPW 312
                          89**************************************************************************************** PP

                  VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldal 180
                          naaelf+l+l+egetirewlffdkprra++sgnrkqrslpdysgrgwhesrkq+mke++g+krsyymdpqp++ fewhl+ey+ine+d +
  GSBRNA2T00084708001 313 NAAELFHLELVEGETIREWLFFDKPRRAYDSGNRKQRSLPDYSGRGWHESRKQLMKEQEGQKRSYYMDPQPPGLFEWHLFEYQINESDVC 402
                          ****************************************************************************************** PP

                  VOZ 181 alyrlelklvdekksakgkvskdsladlqkklgrl 215
                          alyrlelk++++kks+kg+v+kd+ladlqkk+ ++
  GSBRNA2T00084708001 403 ALYRLELKVTNGKKSPKGRVAKDPLADLQKKMEKM 437
                          ********************************987 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MSNHEKITCV SSSHQNLVEK LMQLQERFSH LQAARKEGRV GDHAVLEAQI SQNLREWQAE  60
LTAPSPESSL LGGSISQFSE EIARLLKLND EEDDATSSLK EHAAPKPDGF DQSLCPPPEH  120
LEWIDEEPFC QSPFHVNFSS GFEEAVNNTQ PHDQQLHFAF QEFDPSINTA PDFHVQSNLD  180
IASQLDYHLS EVRQEFNNSP SIKLDASENY TDFTTPQSVR VPPPPSAFLG PKCALWDCTR  240
PAHGSDWYLD YCSDYHGNLA LNEDSPGAAP VLRPGGISLK DNLLIDALRA KTLGKNVGIP  300
ECEGAVNTKC PWNAAELFHL ELVEGETIRE WLFFDKPRRA YDSGNRKQRS LPDYSGRGWH  360
ESRKQLMKEQ EGQKRSYYMD PQPPGLFEWH LFEYQINESD VCALYRLELK VTNGKKSPKG  420
RVAKDPLADL QKKMEKMGHL TPEVASDKPS PPTKGRTKST KGVKVATQDT PVPATVANEP  480
EPSSHQ*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles and mesophyll cells of various tissues. Expressed in the root, especially in the root tip. Also detected in stamen filaments, stipules and anthers. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00018PBMTransfer from AT2G42400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00084708001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013687880.10.0transcription factor VOZ2
RefseqXP_013687881.10.0transcription factor VOZ2
RefseqXP_022557286.10.0transcription factor VOZ2
SwissprotQ9SLB90.0VOZ2_ARATH; Transcription factor VOZ2
TrEMBLA0A078FPJ90.0A0A078FPJ9_BRANA; BnaC04g48260D protein
TrEMBLA0A3P6CCF50.0A0A3P6CCF5_BRAOL; Uncharacterized protein
STRINGBra016879.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.10.0vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Koguchi M,Yamasaki K,Hirano T,Sato MH
    Vascular plant one-zinc-finger protein 2 is localized both to the nucleus and stress granules under heat stress in Arabidopsis.
    Plant Signal Behav, 2017. 12(3): p. e1295907
    [PMID:28277968]
  4. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]