PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00084244001
Common NameGSBRNA2T00084244001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 391aa    MW: 43232.7 Da    PI: 8.4736
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00084244001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.69.2e-1853113257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  GSBRNA2T00084244001  53 KPRWNPKPEQIRILEAIFNSgLVNPPREEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 113
                          89*****************99*************************************995 PP

2Wus_type_Homeobox110.97.1e-3652114264
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                          +++RW+P+peQi+iLe++++sGl++P++eei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++k
  GSBRNA2T00084244001  52 PKPRWNPKPEQIRILEAIFNSGLVNPPREEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 114
                          689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-743112IPR009057Homeodomain-like
PROSITE profilePS5007110.54449114IPR001356Homeobox domain
SuperFamilySSF466898.98E-1250117IPR009057Homeodomain-like
SMARTSM003898.0E-851118IPR001356Homeobox domain
CDDcd000865.68E-852114No hitNo description
PfamPF000462.1E-1553113IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPHQHQ WQHDMNSPLL PSPASHRSSP FTGCEVERSP EPKPRWNPKP  60
EQIRILEAIF NSGLVNPPRE EIRRIRAQLQ EYGQVGDANV FYWFQNRKSR SKHKLRLLHN  120
HSKHSLPPPQ PQPQPQPLSS ASSSSSSSSS SSKSTKLPKT KNKKNNNNTN LSLGGGSQMM  180
GVFPPEASFL FPASTDGGFE GIPVSSQLGF FPGDMVEQPK PAPPTVGPCT GILLSEIMNS  240
SVGYGIHNHQ QLSEKEDEEM RMKMLQQPQI CYAATSDQIS SYNNNNNNIM LHVPPTASTT  300
TTSNPLAIVP STLDQLQVQA GARIRVFINE MEFEVSPGQF NVRDAFGEEV VLINSAGQPI  360
VTDEYGVAIH PLQHGASYYL VLFPSLFVFI *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.110110.0microspore-derived embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013674880.10.0PREDICTED: WUSCHEL-related homeobox 9-like
SwissprotQ6X7J40.0WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLA0A078JNV80.0A0A078JNV8_BRANA; BnaCnng62530D protein
STRINGBra005464.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72062640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.11e-179homeobox-3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]