PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00081027001
Common NameGSBRNA2T00081027001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 328aa    MW: 36111.5 Da    PI: 10.1444
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00081027001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.86.9e-1087130447
                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          WT+eE+   + + ++lG+g+W+ I+r+   +Rt+ q+ s+ qk+
  GSBRNA2T00081027001  87 WTEEEHRMYLLGLEKLGKGDWRGISRKYVRTRTPTQVASHAQKH 130
                          ******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.105.2E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129414.80879135IPR017930Myb domain
SuperFamilySSF466895.83E-1681136IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-1482133IPR006447Myb domain, plants
SMARTSM007171.5E-883133IPR001005SANT/Myb domain
PfamPF002491.1E-787130IPR001005SANT/Myb domain
CDDcd001675.36E-987131No hitNo description
Gene3DG3DSA:1.10.10.602.1E-887130IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MTRRCSHCNH NGHNSRTCPS RGVMLFGVRL TGGSIRKSVS MGNLLSHGHG SGSPGAVPDH  60
VAGDGYTSEG FVAGSSSSRE RKKGAIWTEE EHRMYLLGLE KLGKGDWRGI SRKYVRTRTP  120
TQVASHAQKH FMRLSDVSRR KRRSSLFDMI PHEGGDTPLD LQAPKAENTR VETKMQRGDS  180
VHQTFARNSI HATSIFKIEE SESMDSTNST IKEPTPPTTQ LRSQPQPQRP GSYPVLYPGY  240
FSPYYPFPFP VWSAGYVLEP AKKEETHEIL RPTAVHSKAP FNVNGLLGMT TKLSLGEPKE  300
NGESDQSLSL KLGGGSETRQ SPFHPNA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2367840.0AC236784.1 Brassica napus clone JBnB009P12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013714088.10.0PREDICTED: uncharacterized protein LOC106417921
TrEMBLA0A078JQ540.0A0A078JQ54_BRANA; BnaCnng61080D protein
STRINGBra017487.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34262759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-153MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]