PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00080951001
Common NameGSBRNA2T00080951001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 196aa    MW: 22415.3 Da    PI: 8.4846
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00080951001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.2e-1074132563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          +r +rk  NRe+A+rsR +K++ ++e      +L+ +N++Lk++l+ +  ++++ k+e+
  GSBRNA2T00080951001  74 RRKKRKSLNRESAKRSRVKKQKHLDEISIQLNQLKIQNRKLKNQLQYIYYHCQRTKMEN 132
                          78999999**********************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.1E-966126No hitNo description
SMARTSM003382.6E-770134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.25472135IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-874123No hitNo description
PfamPF001703.2E-774132IPR004827Basic-leucine zipper domain
CDDcd147021.26E-1475119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MSTISPVFSC EPGLTAPVQA SESGFTSWDI SHLFSFLDSS STNIIPDSAS EYLRPGSVNR  60
TGSNVDLADC TDERRKKRKS LNRESAKRSR VKKQKHLDEI SIQLNQLKIQ NRKLKNQLQY  120
IYYHCQRTKM ENDRLRLEHR MLHDTLLNVR QVLMLCQIES PWIESSSECA TWSYDNSTVV  180
TVQQDPSVIT NHVIV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17394RRKKRKSLNRESAKRSRVKKQK
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00080951001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629467.11e-136PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A078JQ121e-143A0A078JQ12_BRANA; BnaCnng60880D protein
STRINGBo1g080160.11e-135(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.12e-69basic leucine-zipper 5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]