PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00080941001
Common NameGSBRNA2T00080941001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 307aa    MW: 33489.2 Da    PI: 7.0873
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00080941001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.98.1e-071822271863
                          HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          +rsR RK+++i+eLe++v  L+a   +L  ++ +l ++ a+l  e+
  GSBRNA2T00080941001 182 QRSRVRKLQYIAELERRVSMLQAVEADLSVRVASLLQTRATLSLEN 227
                          79******************************99999999988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147035.80E-15176221No hitNo description
Gene3DG3DSA:1.20.5.1708.8E-6182234No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSRPGQLPPR CPIPKKLSLN PYADTFYSSS SPVESYISHH HKSSSPTQDS TLEEQPAWLD  60
ELLGDKTDCG GPSPLRRSAS DSVVLLGDIS ADFAGFNQSE EDEESLTSEA CGELESACVY  120
GPNSPRARNS SSFSGSPIAS AFSDYGSQKA PQNADDTVKG SICHPHEADN ACGSNAKRNP  180
GQRSRVRKLQ YIAELERRVS MLQAVEADLS VRVASLLQTR ATLSLENSQM KQQMAILKQD  240
KLIREGEYLL LKKEAQRLNS RLRNFGSSNN NNRLARSYSA GSSIGPRTVS SHLDWNLLDL  300
TKLNLN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00080941001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0998811e-134AY099881.1 Arabidopsis thaliana unknown protein (At5g04840) mRNA, complete cds.
GenBankBT0087101e-134BT008710.1 Arabidopsis thaliana At5g04840 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013729394.10.0basic leucine zipper 2
TrEMBLA0A078I6X00.0A0A078I6X0_BRANA; BnaC09g50830D protein
STRINGBo9g179040.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1364279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.22e-18bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]