PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00080490001
Common NameGSBRNA2T00080490001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 143aa    MW: 15871.8 Da    PI: 6.4916
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00080490001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR35.61.8e-116397135
                  TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCed 35
                         k++kgC+Ckks   kkYCeCf+a++ Cse+  C++
  GSBRNA2T00080490001 63 KHNKGCHCKKSGYFKKYCECFQANNLCSENWDCKN 97
                         589**************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163420.2851103IPR005172CRC domain
SMARTSM011141.3E-863101IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-76697IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MYLIGFVSGT YCDGWNCVNC FNKVDNEPAR RDAAETTMER NPNAFSPKKL LAEEIGKVVL  60
LGKHNKGCHC KKSGYFKKYC ECFQANNLCS ENWDCKNFEG SEERQALFHG EHANNIAYLH  120
QEANAAIHEA VGSSGFSLSP EP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-13110924132Protein lin-54 homolog
5fd3_B2e-13110924132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00080490001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129079.11e-70PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-67TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A078I6421e-102A0A078I642_BRANA; BnaA04g10170D protein
TrEMBLM4E9Y31e-102M4E9Y3_BRARP; Uncharacterized protein
STRINGBra025590.1-P1e-102(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.15e-70Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]