PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00080436001
Common NameGSBRNA2T00080436001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 182aa    MW: 19867.5 Da    PI: 8.2084
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00080436001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.27.8e-4512110199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l
  GSBRNA2T00080436001  12 PCAACKFLRRKCMPGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHRL 101
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          ++el+++++
  GSBRNA2T00080436001 102 QKELDAANA 110
                          ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.18311112IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-4412109IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MASSSSNTYN SPCAACKFLR RKCMPGCIFA PYFPPEEPHK FANVHKIFGA SNVTKLLNEL  60
LPHQREDAVN SLAYEAEARV RDPVYGCVGA ISYLQRQVHR LQKELDAANA DLVQYGLSTS  120
TPGNVVDLVF QPQPFPPQPL NPVYRLSGAS PVMTQQPRGT GGSYGTFLPW NNGHDQQGGN  180
M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-6521221127LOB family transfactor Ramosa2.1
5ly0_B1e-6521221127LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}.
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00080436001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0082651e-171AB008265.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDC12.
GenBankAB1643051e-171AB164305.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like gene 4 protein, partial cds.
GenBankAB4738371e-171AB473837.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like 4 protein, complete cds.
GenBankAF4478971e-171AF447897.1 Arabidopsis thaliana LOBa (LOB) mRNA, complete cds; alternatively spliced.
GenBankBT0257451e-171BT025745.1 Arabidopsis thaliana At5g63090 mRNA, complete cds.
GenBankCP0026881e-171CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626660.11e-134PREDICTED: protein LATERAL ORGAN BOUNDARIES isoform X1
RefseqXP_013626661.11e-134PREDICTED: protein LATERAL ORGAN BOUNDARIES isoform X1
RefseqXP_013626662.11e-134PREDICTED: protein LATERAL ORGAN BOUNDARIES isoform X1
SwissprotQ9FML41e-123LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A078JMX61e-133A0A078JMX6_BRANA; BnaCnng60770D protein
TrEMBLA0A0D3BFI81e-133A0A0D3BFI8_BRAOL; Uncharacterized protein
TrEMBLA0A3P6BCK01e-133A0A3P6BCK0_BRAOL; Uncharacterized protein
STRINGBo3g104760.11e-133(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-117LBD family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  3. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]