PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00079440001
Common NameGSBRNA2T00079440001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 526aa    MW: 59088.1 Da    PI: 5.7027
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00079440001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS382.74.4e-1171415233374
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalkl.fsevsPi 90 
                          + Lle+A+a+s++d+++aq++L++l+el+sp+gd+ q+la+yf++AL +r+++s++++y+ + + +++ek+ s e++  + l f+evsP+
  GSBRNA2T00079440001 141 SILLEAARAFSDKDTTRAQQILWTLNELSSPYGDTEQKLASYFLQALFNRMTGSGERCYRDMVTAAATEKTcSFEQTRKTMLkFQEVSPW 230
                          689***********************************************************999999888543443333337******* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg......skeeleetgerLakfAeelgv 174
                          ++f+h++aN aIlea++ge ++Hi+D++ + ++QWp+Ll+aLa+R++++p+lR+T+++ +++       s++ ++e+g+r++kfA+ +gv
  GSBRNA2T00079440001 231 VTFGHVAANGAILEAIDGEAKIHIVDISTTFCTQWPTLLEALATRSDDTPHLRLTTIVVANKYvndqtaSRRVMKEIGHRMEKFARLMGV 320
                          *********************************************************99877789999999******************* PP

                 GRAS 175 pfefnvlvak.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.nse....sFlerfl 258
                          pf fn++++  +l+++++++L++k++E+laVn+v ++h +     +  ++rd++++ +++l+P+++++ve+ead+ ++e    +F++ f 
  GSBRNA2T00079440001 321 PFTFNIIHHAgDLSEFDPNKLDIKSDEVLAVNCVGAMHGVA----PCGNPRDALISKLRRLRPRIMTIVEEEADLvGEEgfddEFFRLFG 406
                          *******7777*****************************8....888899************************777666667888899 PP

                 GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg 348
                          e+l+++ ++f+sle+++pr+s er ++Er+  gr+iv++vace ++++er+et++kW++r+++ GF +v +s+++a+++++llr++k +g
  GSBRNA2T00079440001 407 ESLRWFRVCFESLEESFPRTSTERLMLERA-AGRAIVDLVACEPSDSTERRETARKWSMRMRNGGFDAVGYSDEVADDVRALLRRYK-EG 494
                          ******************************.********************************************************.44 PP

                 GRAS 349 ..yrveeesgslv.lgWkdrpLvsvSaWr 374
                             +v++++++ + l+W+d+p+v++SaWr
  GSBRNA2T00079440001 495 vwSMVQCSDAAGIfLCWRDQPVVWASAWR 523
                          44788876665555**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.799113501IPR005202Transcription factor GRAS
PfamPF035141.5E-114141523IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MDTLFTLVSL QQQQSHSIIT NKSSQSRTST TTTGSPQTAY HYNFPQSDAV EECLNFFMDE  60
EDLSSSNSSQ HNHHHNNNPS NYYSPFTTST QYHPATSPTP STTVVLASPY SSGHHHDPSA  120
FSIPQTPPSF DFSANAKWAD SILLEAARAF SDKDTTRAQQ ILWTLNELSS PYGDTEQKLA  180
SYFLQALFNR MTGSGERCYR DMVTAAATEK TCSFEQTRKT MLKFQEVSPW VTFGHVAANG  240
AILEAIDGEA KIHIVDISTT FCTQWPTLLE ALATRSDDTP HLRLTTIVVA NKYVNDQTAS  300
RRVMKEIGHR MEKFARLMGV PFTFNIIHHA GDLSEFDPNK LDIKSDEVLA VNCVGAMHGV  360
APCGNPRDAL ISKLRRLRPR IMTIVEEEAD LVGEEGFDDE FFRLFGESLR WFRVCFESLE  420
ESFPRTSTER LMLERAAGRA IVDLVACEPS DSTERRETAR KWSMRMRNGG FDAVGYSDEV  480
ADDVRALLRR YKEGVWSMVQ CSDAAGIFLC WRDQPVVWAS AWRPT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-311435238375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00079440001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2337520.0AF233752.1 Arabidopsis thaliana short-root protein (shr) gene, complete cds.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankBT0330260.0BT033026.1 Arabidopsis thaliana unknown protein (At4g37650) mRNA, complete cds.
GenBankAL1615910.0AL161591.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 87.
GenBankAL0356050.0AL035605.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F19F18 (ESSA project).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013656589.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLA0A078I1S60.0A0A078I1S6_BRANA; BnaA08g15740D protein
STRINGBra010606.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61042547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]