PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00079090001
Common NameGSBRNA2T00079090001, LOC106410846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 373aa    MW: 40470.5 Da    PI: 4.5617
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00079090001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.96.1e-15217270356
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                          ++kr+rr+ +NRe+ArrsR+RK++++ e    v +L +e +++ k+l+e +++ 
  GSBRNA2T00079090001 217 DVKRARRMLSNRESARRSRRRKQEQMSEFDSQVGQLRGEHSTMLKRLSEVTQKF 270
                          68*********************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-10213271No hitNo description
SMARTSM003382.7E-15215279IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.507217269IPR004827Basic-leucine zipper domain
PfamPF001701.8E-12218270IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.3E-10218269No hitNo description
PROSITE patternPS000360222237IPR004827Basic-leucine zipper domain
PfamPF124988.6E-10286345IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MKSGFSADDS TDSFWPPPPP SPPLSPGDGM TRSQSEWAFQ MLLEEISSVP AGSSISSSSA  60
TDNAIGRSYT QVRSESSVSR TEEASSNVVE MPKPSRNGAP SWSVEEMDPN YYQAILKSKL  120
ELACAAVALR VSTTVTPEDS SASSGNQNQV SPVGSQTQGY AVAQMSPAVS SVSDAPSLDT  180
QRQRDIQSRL ANSGSDDSDD EDPDGETVTT VNDDPTDVKR ARRMLSNRES ARRSRRRKQE  240
QMSEFDSQVG QLRGEHSTML KRLSEVTQKF STAVVDNRIL KADIETLRTK VKMAEDTVKR  300
VTGMNPRLLA KPYSIPFDRT LMGSSQPNLN QTDMIPNQIS EDNSFASNSV VTLESGCNAF  360
EATSWICDKD AP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231238RRSRRRKQ
2233238SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.28560.0seed| vegetative meristem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First observed in seeds at early stages of development, mostly in embryo and, at lower extent, in the endosperm. Accumulates and peaks at maturation. Fade out during late seed development steps, restricted to the inner layer of the seed coat, and, at very low levels, in the mature embryo and the remaining endosperm. Also present in the lignified inner subepidermal layer of the valves. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, stems, leaves, stipulae, siliques, seeds, pollen, and flowers. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'-ACGT-3' box, especially present in G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of seed storage protein (SSP) encoding gene promoters (e.g. At2S and CRU3) and promotes their expression in seeds when in complex with ABI3 and BZIP53. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:19261733, ECO:0000269|PubMed:19531597}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00079090001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013706923.10.0basic leucine zipper 25
SwissprotQ9M1G62e-79BZP25_ARATH; Basic leucine zipper 25
TrEMBLA0A078FPZ60.0A0A078FPZ6_BRANA; BnaC03g21720D protein
STRINGBo3g032910.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2025756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.11e-67basic leucine zipper 25
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Jain P, et al.
    A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation.
    Sci Rep, 2017. 7(1): p. 14343
    [PMID:29084982]
  5. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]