PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00078275001
Common NameGSBRNA2T00078275001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 308aa    MW: 34663.7 Da    PI: 9.4641
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00078275001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.82.7e-09178235562
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          kr +r+  NR +A rs +R  ++i++Le kv++L+ e ++L   l  l+     l+++
  GSBRNA2T00078275001 178 KRVKRMLANRASAARSKERETQYIAKLEHKVQTLQIETTTLSAHLTYLQRDNMGLQNQ 235
                          999***************************************9998888776666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.7E-13174238IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.174176239IPR004827Basic-leucine zipper domain
PfamPF001704.8E-8178236IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-10178235No hitNo description
SuperFamilySSF579593.21E-10178234No hitNo description
CDDcd147034.05E-18179230No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MYHSPSRVVA GGSGNLPPRN SHRRSNSDHT FVFSSMSPPL IPSKSLERSV SSCGEASDWS  60
KLVKEEERRT FSEGYDDALR AYMRLDKLDA ERSRGRTRKM TNGGSTGGDS EGESNVKRRA  120
GGDIAPTSGH YRSVSLDSCC FREDDYSVRF GKYEFSAGDM KKIAADETLA GIVMADPKRV  180
KRMLANRASA ARSKERETQY IAKLEHKVQT LQIETTTLSA HLTYLQRDNM GLQNQNNELK  240
FRLQSMEQQT QLRNALSEKL TEEFQRLSLV IGVPNRSESN ISNASLTPEM FQQQLRISQL  300
QHQHYNE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00078275001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894800.0AC189480.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB082F21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660136.10.0probable transcription factor PosF21
TrEMBLA0A078FHB80.0A0A078FHB8_BRANA; BnaA09g43320D protein
STRINGBra031172.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2035456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.11e-101bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]