PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00077662001
Common NameGSBRNA2T00077662001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 532aa    MW: 57787.3 Da    PI: 5.2436
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00077662001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.43.8e-25255311259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ +++v+i+ +g H he
  GSBRNA2T00077662001 255 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSECCAKK-IECSNDSGNMVQIVTKGLHSHE 311
                          6********************************98.*********************8 PP

2WRKY97.58.6e-31419475359
                          -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++ +v+itY+geHnh+
  GSBRNA2T00077662001 419 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVENTGAVVITYKGEHNHD 475
                          9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.57E-19252313IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.7E-20252313IPR003657WRKY domain
SMARTSM007741.6E-22254312IPR003657WRKY domain
PROSITE profilePS5081116.65256313IPR003657WRKY domain
PfamPF031067.2E-17256310IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-31403477IPR003657WRKY domain
PROSITE profilePS5081132.592412477IPR003657WRKY domain
SuperFamilySSF1182902.62E-26413477IPR003657WRKY domain
SMARTSM007742.3E-35417476IPR003657WRKY domain
PfamPF031063.3E-23419475IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MEKSTQETVK KEKVKPEKEL CDGLSQLRDE ESLGTIGDDM EDVHDEAIRE VVLAKDQVEE  60
NSPVEPNDQD VREVKETSPA LTASLDPSLV DPSLPSDPSA AQGQGLSLLE QKSDSRVVDN  120
LSVSPVLRKD SGKEDVSVVA PVDEVAVENQ QKSDSQVVNN LSVSPVLKTD SDKEEVASAV  180
LPVNEVAVES HEVETSPALT PSSNPLVEPS LPSNPSAAQD QGLSLLDQNS DSQKSYDPRV  240
VRNLSVSPGL RTPPRDGYNW RKYGQKQVKS PKGSRSYYRC TYSECCAKKI ECSNDSGNMV  300
QIVTKGLHSH EPPRKSSFSP REIGAASAVT PVLEVDTVVA TVPSVSATPP PTKENICQSP  360
TTIERKRTCE NEAVEEPEPK RRQVLLKNDN TQSSDFVSKP GKKHKLVVHA AGDVGISCDG  420
YRWRKYGQKM VKGNPNPRNY YRCTSAGCPV RKHIETAVEN TGAVVITYKG EHNHDTPVPK  480
KRHDTPSSVL LSPASMRTRL DDQVNIPSSS QCLVGRESEK QSSEALDVVG G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-24405477274WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.215610.0flower| root| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00077662001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931560.0KM593156.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY82) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013707517.10.0PREDICTED: probable WRKY transcription factor 32 isoform X3
SwissprotP595831e-176WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A078FJP40.0A0A078FJP4_BRANA; BnaA03g51140D protein
STRINGBra024035.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-170WRKY DNA-binding protein 32
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]