PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00077375001
Common NameGSBRNA2T00077375001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 252aa    MW: 28555.1 Da    PI: 10.2194
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00077375001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.47.7e-2190149357
                          --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          +R+++t+eq+++Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  GSBRNA2T00077375001  90 TRWNPTQEQIKILEILYKGgMRTPNAQQIEHITSQLgkygKIEGKNVFYWFQNHKARERQ 149
                          7*****************99**************************************97 PP

2Wus_type_Homeobox116.41.3e-3790151465
    Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          tRW+Pt+eQikiLe lyk G+rtPn+++i++it++L +yGkie+kNVfyWFQN+kaRerqkq
  GSBRNA2T00077375001  90 TRWNPTQEQIKILEILYKGGMRTPNAQQIEHITSQLGKYGKIEGKNVFYWFQNHKARERQKQ 151
                          8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.94485150IPR001356Homeobox domain
SuperFamilySSF466891.45E-1286154IPR009057Homeodomain-like
SMARTSM003892.8E-787154IPR001356Homeobox domain
CDDcd000865.77E-590151No hitNo description
PfamPF000461.9E-1890149IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.0E-891149IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MKVHEFSNGF SSWEQQQESP SSFSCKRFRP LAPKLSGSPS SPPSSSSGVT SATFDLKSFI  60
KPDQAAPTKS HYSLEHKRDF SQVEMHPGGT RWNPTQEQIK ILEILYKGGM RTPNAQQIEH  120
ITSQLGKYGK IEGKNVFYWF QNHKARERQK QKRNNLSLSC QGSLSTTSVS NASVTMKTRT  180
SSSPDFKREP MVMKELLEEN EYKRTCRSWG FENLKIESRR NINSSINATI ATTFNIDNVT  240
LELFPLHPEG R*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.249860.0stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00077375001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009145045.10.0PREDICTED: WUSCHEL-related homeobox 4-like
SwissprotQ6X7J91e-124WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A078I3Z80.0A0A078I3Z8_BRANA; BnaA05g18600D protein
TrEMBLM4ETT00.0M4ETT0_BRARP; Uncharacterized protein
STRINGBra032212.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59802747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.11e-118WUSCHEL related homeobox 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]