PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00075747001
Common NameGSBRNA2T00075747001, LOC106425457, LOC106437465
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 536aa    MW: 59196.3 Da    PI: 6.3671
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00075747001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS402.54.1e-1231585281374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l+e+L+e+A+avs+gd+++a  ++  l++++s +g+p+qRl +y++e+L+arl++++ ++y+al+++e +     e ++++ +++e++P+
  GSBRNA2T00075747001 158 LKEVLVEAAQAVSEGDFAAACGFIDVLEQMVSVSGTPIQRLGTYMAEGLRARLQGTGGNIYRALKCNEPT---GRELMSYMGVLYEICPY 244
                          5789*****************************************************************9...99999999********* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           kf++ +aN aIleav+ge+rvHiiDf+i qG+Q++ L+++La+ p+gpp lR+Tgv++++s   +   l+ +ge+La+ A+++gvpfef
  GSBRNA2T00075747001 245 WKFAYTAANAAILEAVAGEKRVHIIDFQIAQGTQYMFLINELAKLPGGPPLLRVTGVDDSQSRfaRGGGLNLVGEKLANKAQSCGVPFEF 334
                          ***********************************************************99989999*********************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +  +  +  +++ e+L v+pg a++Vn+ + lh+++desvs+e++rd++L+l+ksl Pk+v++veqe+++n+++Fl rf+e+l+yy+a+f
  GSBRNA2T00075747001 335 HD-AIMSGCKVHREHLGVEPGFAVVVNFPYVLHHMPDESVSVENHRDRLLHLIKSLGPKLVTLVEQESNTNTSPFLSRFVETLDYYTAMF 423
                          **.788899999****************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          +s++a  pr++++ri+ E+++++r+ivn++ace+aer+erhe l+kWr r+++aGF   p+s++aa  a+ +l+ ++++ y++ e++g+l
  GSBRNA2T00075747001 424 ESIDAARPRDDKQRISAEQHCVARDIVNMIACEEAERVERHEVLGKWRVRMMMAGFMGWPVSSSAAFAASEMLKGYDKN-YKLGESEGAL 512
                          *****************************************************************************66.********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          +l Wk+rp+ ++SaW+
  GSBRNA2T00075747001 513 YLFWKRRPMATCSAWK 528
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.864132509IPR005202Transcription factor GRAS
PfamPF035141.4E-120158528IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MQTSQKHHSA AGLHMLYPQV HCSPQFQVID KKNKKNAFSD TTPSKESFFT LESSTASGPL  60
PSYESPSVSI TSGRSPFSPQ ASCISDLHPS PENIYESPLS GASSHVYDEA HVKNKIRELE  120
VSLLSVDPKV EEYSGFSPAA GKSWNWDELL ALTPQLDLKE VLVEAAQAVS EGDFAAACGF  180
IDVLEQMVSV SGTPIQRLGT YMAEGLRARL QGTGGNIYRA LKCNEPTGRE LMSYMGVLYE  240
ICPYWKFAYT AANAAILEAV AGEKRVHIID FQIAQGTQYM FLINELAKLP GGPPLLRVTG  300
VDDSQSRFAR GGGLNLVGEK LANKAQSCGV PFEFHDAIMS GCKVHREHLG VEPGFAVVVN  360
FPYVLHHMPD ESVSVENHRD RLLHLIKSLG PKLVTLVEQE SNTNTSPFLS RFVETLDYYT  420
AMFESIDAAR PRDDKQRISA EQHCVARDIV NMIACEEAER VERHEVLGKW RVRMMMAGFM  480
GWPVSSSAAF AASEMLKGYD KNYKLGESEG ALYLFWKRRP MATCSAWKPN PNQIV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-5319152836375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00075747001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325680.0AC232568.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH122A22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013721644.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_013733812.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A078I1L40.0A0A078I1L4_BRANA; BnaA01g17860D protein
STRINGBra026237.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]