PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00073245001
Common NameGSBRNA2T00073245001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 302aa    MW: 33280.4 Da    PI: 7.8694
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00073245001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.2e-144286147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         r +WT+eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
  GSBRNA2T00073245001 42 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 86
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-173692IPR009057Homeodomain-like
PROSITE profilePS5129416.2913791IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-74092IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-194089IPR006447Myb domain, plants
SMARTSM007171.1E-114189IPR001005SANT/Myb domain
PfamPF002497.2E-124286IPR001005SANT/Myb domain
CDDcd001672.35E-94487No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MNSSPTRNPT SAEVTPPLSS TSTAAEGSSK KVRKPYTITK SRESWTEEEH DKFLEALQLF  60
DRDWKKIEDF VGSKTVIQIR SHAQKYFLKV QKNGTLAHVP PPRPKRKSAH PYPQKASKNA  120
QMPLQVSTSF TSRNSDMAGG YTSWDDVSMM LNRVISPRQE LVTLPGAEGM LFNDIRSKGL  180
LDVISPSTSG MGSSSRPVSG SEFIVQQPPV LQAVPDFAEV YNFIGSVFDP EKRGHVEKLK  240
EMDPVNFETV LLLMRNLTVN LSNPDLESSR NVLSSDEVNT EIPSVTTGSF VPNSTSDKSD  300
S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.117580.0flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00073245001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638230.10.0PREDICTED: protein REVEILLE 8 isoform X1
SwissprotQ8RWU31e-172RVE8_ARATH; Protein REVEILLE 8
TrEMBLA0A078HXZ30.0A0A078HXZ3_BRANA; BnaC05g43350D protein
STRINGBra029778.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93032633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-160MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]