PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00072361001
Common NameGSBRNA2T00072361001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 323aa    MW: 35596.9 Da    PI: 9.7223
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00072361001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.86.8e-1087130447
                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          WT+eE+   + + ++lG+g+W+ I+r+   +Rt+ q+ s+ qk+
  GSBRNA2T00072361001  87 WTEEEHRMYLLGLEKLGKGDWRGISRKYVRTRTPTQVASHAQKH 130
                          ******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.1E-4236IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129414.80879135IPR017930Myb domain
SuperFamilySSF466895.68E-1681136IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-1482133IPR006447Myb domain, plants
SMARTSM007171.5E-883133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-887130IPR009057Homeodomain-like
CDDcd001675.17E-987131No hitNo description
PfamPF002491.1E-787130IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MTRRCSHCNH YGHNSRTCPS RGVMLFGVRL TGGSIRKSAS MGNLLSHGHG SGSPGDVPDH  60
VAGDGYTSEG FVAGSSSSRE RKKGAIWTEE EHRMYLLGLE KLGKGDWRGI SRKYVRTRTP  120
TQVASHAQKH FMRLSDVSRR KRRSSLFDMI PHEGGDTPLD LQAPKAENTR VETKMQRGDS  180
VHQTFACNSI HATIEESELM DSTNSTIKEP TPTTQVRSQP QPQRPGSYPV LYPGYFSPYY  240
PFPFPVWSAG YVLEPAKKEE THEIFRPTAV HSKAPFNVNG LLGMTTKLSL GEPKENGESD  300
QSLSLKLGGG SETRQSPFHP NA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00072361001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1553470.0AC155347.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH093K03, complete sequence.
GenBankAC1553430.0AC155343.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH077A05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013728352.10.0PREDICTED: uncharacterized protein LOC106432055
TrEMBLA0A078HUN60.0A0A078HUN6_BRANA; BnaA09g18280D protein
STRINGBra017487.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34262759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-149MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]