PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00069628001
Common NameGSBRNA2T00069628001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 633aa    MW: 68730.2 Da    PI: 7.0011
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00069628001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-093513881954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  GSBRNA2T00069628001 351 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 388
                          554459******************************88 PP

2BELL123.68e-40210281172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqe+q+kkakL s+l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  GSBRNA2T00069628001 210 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQI 281
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.3E-77130279IPR006563POX domain
PfamPF075263.7E-47136278IPR006563POX domain
PROSITE profilePS5007112.26329392IPR001356Homeobox domain
CDDcd000862.30E-12332393No hitNo description
SMARTSM003892.3E-9332396IPR001356Homeobox domain
SuperFamilySSF466895.56E-17333399IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-29335398IPR009057Homeodomain-like
PfamPF059202.6E-18349388IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MAAYFHGNPS EISAGPDGGL QTLILMNPTT YVQYTQQDDD SNNNNNSNNN VNNNNSFQFV  60
GIPLSGHEAA SITAADNIST PRAQRGLSLS LSSQQQQQQQ QHQTLHHVGF GSGPGEDIRV  120
GPGSTGSGVT NGIANLVSSK YLKAAQELLD EVVNADSNDI NIKSQLFSSK KGTSGTDNKA  180
VGESSTGAGE GSGGGGEASG KRTVELGTAE RQEIQMKKAK LSSMLHEVEQ RYRQYHQQMQ  240
MVISSFEQAA GIGSAKSYTS LALKTISRQF RCLKEAIAGQ IKAANKSLGE EDSVSGVGRL  300
EGSRLKFVDH HLRQQRALQQ LGMIQHPSNN AWRPQRGLPE RAVSVLRAWL FEHFLHPYPK  360
DSDKHMLAKQ TGLTRSQVSN WFINARVRLW KPMVEEMYTE EMKEQGKNMG SMEKTPNMDQ  420
NNEDSASKST SNQEKSPMGG GGADNYHMNP NHNGDLEGVT GMQGSPKRLR TSEETMMQPI  480
NADFSSNEKL TMKILEERQG LRSDGGYPFM GNFGQYQMDE MSRFEVAVSD QELLAQRYSG  540
NNNGVSLTLG LPHCDSLSST HHQGFMQTHH GIPIGRRVKI GEADDYGAAA LNGGGGSAAT  600
VHSSATAAAA YNGMNIQNQK RYVAQLLPDF VA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-17338395158Homeobox protein Meis1
4xrs_B5e-17338395158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.45240.0flower| leaf| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00069628001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141536.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009141537.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A078HPE20.0A0A078HPE2_BRANA; BnaA04g20970D protein
STRINGBra017277.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]