PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00068959001
Common NameGSBRNA2T00068959001, LOC106363908
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 164aa    MW: 18034.7 Da    PI: 8.1321
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00068959001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.14.2e-45131121100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC++dCv+apyfpa++p kfa+vhk+FGasnv+k+l+ l+e++r+da++s+vyeA+ar++dPvyG+vg+i++lq+qle+l
  GSBRNA2T00068959001  13 PCAACKLLRRKCVEDCVFAPYFPAKEPYKFAIVHKIFGASNVSKMLQVLSENHRSDAVNSIVYEANARVQDPVYGCVGIISSLQRQLETL 102
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++la +++e
  GSBRNA2T00068959001 103 QTQLAFAQAE 112
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.59612113IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4313110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MRRNGHSHGA VSPCAACKLL RRKCVEDCVF APYFPAKEPY KFAIVHKIFG ASNVSKMLQV  60
LSENHRSDAV NSIVYEANAR VQDPVYGCVG IISSLQRQLE TLQTQLAFAQ AELVHMKTLH  120
RIDTKPPPYM ASGISFPANK DLSNDVDMAF AYENGAGESL WSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-4591147112LOB family transfactor Ramosa2.1
5ly0_B9e-4591147112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. At the bases of lateral organs formed from vegetative, inflorescence, and floral meristems. {ECO:0000269|PubMed:12068116, ECO:0000269|PubMed:17485849}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00068959001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin. {ECO:0000269|PubMed:17485849}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013659026.11e-121LOB domain-containing protein 3
SwissprotQ9SA514e-97LBD3_ARATH; LOB domain-containing protein 3
TrEMBLA0A078HS021e-120A0A078HS02_BRANA; BnaC05g12610D protein
TrEMBLA0A3N6QCN11e-120A0A3N6QCN1_BRACR; Uncharacterized protein
TrEMBLA0A3P6FEE11e-120A0A3P6FEE1_BRAOL; Uncharacterized protein
STRINGBo5g021980.11e-120(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.13e-89ASYMMETRIC LEAVES 2-like 9
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]