PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00068769001
Common NameGSBRNA2T00068769001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 372aa    MW: 42038.5 Da    PI: 9.5122
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00068769001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1223.5e-072402761753
                          HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                          A+rsR RK+++i eLe+ v++L+ae ++    l+ l+
  GSBRNA2T00068769001 240 AQRSRVRKLQYISELERTVQALQAEGSKVSADLDFLN 276
                          89***********************888777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.7E-5224299No hitNo description
CDDcd147032.76E-14232279No hitNo description
SuperFamilySSF579592.38E-5240282No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MASSKGTQSV KDLMHPGKNA LLPPKIPFPT VSAPYSEYIP LGSRHHGHKL NDEKPHHHHH  60
HQRTSSESDL VEEPPFWLDD LLNEPESPVR KCGHRRSSSD SYAYLDMANA KNISLTLQND  120
FSYRNTGSST QRGGVHELDW NQNAAFYSDS NFLNQTNRQR DSLVAASGPR PSWQPFTRES  180
VGGKHMGSSS YMPQEAPETK NYAKTLSHDA KKFSPEQKHS NAQPVTCDAD NTRRAKQQFA  240
QRSRVRKLQY ISELERTVQA LQAEGSKVSA DLDFLNQRNL ILSMENKALK QRLESIAQEK  300
LIKQMEQELL EKEIGRLRAL YQQQQQTQQP QASHKRAGSK DLDSQFSSLS LNSKDSNSSR  360
DSVSVTSQFH F*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.106780.0microspore-derived embryo| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00068769001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009113332.10.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLA0A078HT200.0A0A078HT20_BRANA; BnaA09g14950D protein
STRINGBra027885.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-164bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]