PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00067696001
Common NameGSBRNA2T00067696001, LOC106432091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 599aa    MW: 66080.2 Da    PI: 5.3229
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00067696001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS318.91.1e-972295972374
                 GRAS   2 velLlecAeavssgdle.....laqalLarlselaspdgd......pmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80 
                          +e+L+++Ae + +++++     laq +Larl+++ s + +      p+qR+a+++teAL + +++         +p   s++n++ ++aa
  GSBRNA2T00067696001 229 IEQLFNAAELIGNNNNNgdhtaLAQGILARLNHHLSYSNNnnnknpPFQRAASHITEALLSLINN--------ASPPLISPENMILRIAA 310
                          6899******9997766666669**********95544433467779*****************9........4444455678******* PP

                 GRAS  81 lklfsevsPilkfshltaNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg..skeeleetger 164
                          +++fse+sP+l+f ++taNq Ile+ + e   +r+HiiDfd+++G+QW +L+q+LasR+ + + sl+iT++++p s+  ++ el+ t+e+
  GSBRNA2T00067696001 311 YRTFSETSPFLQFVNFTANQSILESCNDElgfDRIHIIDFDVGYGGQWSSLMQELASRRrNRASSLKITVFAPPPSTvsDEFELRFTEEN 400
                          ***************************99999************************99857778*********9988899********** PP

                 GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnses 252
                          L++fA e+++pfe+++l  + l +  ++  ++++  +Ea+aVnl ++             + + +L+++k++sP+vvv++++ +d+n+++
  GSBRNA2T00067696001 401 LRSFAGEVKIPFEIELLSLELLLNPAYWPVSLRSleKEAVAVNLPVNSVVSG--------YLPFILRFLKQISPNVVVCSDRGCDRNDAP 482
                          ****************97777777788877777766*********9655554........4566************************** PP

                 GRAS 253 FlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr 342
                          F + +++al+y+++l++sl+a+   +s+e+ +vEr++++++i++++++++++     e+ + Wr+ ++++GF+p++ls++a++qa++ll+
  GSBRNA2T00067696001 483 FPNAVIHALQYHTTLLESLDAN---QSQEDESVERFWVQPSIEKLLMKRHRW----IERSQPWRSLFTQCGFSPASLSQTAEAQAECLLQ 565
                          **********************...8**************************....88888***************************** PP

                 GRAS 343 kvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          + +++g++ve+++gslv++W++++Lv+vSaW+
  GSBRNA2T00067696001 566 RSPVRGFHVEKRHGSLVMCWQRKELVTVSAWK 597
                          *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.312202577IPR005202Transcription factor GRAS
PfamPF035143.6E-95229597IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MPLSFERFQG EGVFGVVSSL YSDPQKIWFN QDKTGAEQDL GYVVGGVLPE PTSVLDALRS  60
PSPLASHSST TTTMTLSSSH GGGTVTATAT AVDDKCSQIG LDDLDGGQEQ SILRLIMDPG  120
SGFGVFDPGF GFGSGSVPVN PLLSSSFPYQ EELTFSNPPS SPPAKRFNSG SHQPVFPFPD  180
PGHDPFLVRR QQQFQFPFQF HQQQLPSSSS SLAPVPPPGT AGDDQTVIIE QLFNAAELIG  240
NNNNNGDHTA LAQGILARLN HHLSYSNNNN NKNPPFQRAA SHITEALLSL INNASPPLIS  300
PENMILRIAA YRTFSETSPF LQFVNFTANQ SILESCNDEL GFDRIHIIDF DVGYGGQWSS  360
LMQELASRRR NRASSLKITV FAPPPSTVSD EFELRFTEEN LRSFAGEVKI PFEIELLSLE  420
LLLNPAYWPV SLRSLEKEAV AVNLPVNSVV SGYLPFILRF LKQISPNVVV CSDRGCDRND  480
APFPNAVIHA LQYHTTLLES LDANQSQEDE SVERFWVQPS IEKLLMKRHR WIERSQPWRS  540
LFTQCGFSPA SLSQTAEAQA ECLLQRSPVR GFHVEKRHGS LVMCWQRKEL VTVSAWKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2927059734375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.67060.0leaf| seed| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894450.0AC189445.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB070L01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013728382.10.0PREDICTED: scarecrow-like protein 27
SwissprotQ7XJM80.0SCL27_ARATH; Scarecrow-like protein 27
TrEMBLA0A078JM970.0A0A078JM97_BRANA; BnaCnng57010D protein
STRINGAT2G45160.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134171828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45160.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]